Crystal structure of CobB Ac2 (A76G,I131C,V162A) in complex with H4K16-Crotonyl peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Apr 2020.
Explore 6RXP in 3D Show helices and sheets RCSB PDB PDBe
6RXP contains 28 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-47 | 5 | 1 |
| α-helix | 50-53 | 4 | |
| β-strand | 61 | 1 | 2 |
| β-strand | 66-67 | 2 | 2 |
| β-strand | 70-71 | 2 | 2 |
| α-helix | 72-75 | 4 | |
| α-helix | 78-83 | 6 | |
| α-helix | 85-99 | 15 | |
| α-helix | 108-120 | 13 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-128 | 5 | 1 |
| α-helix | 134-138 | 5 | |
| β-strand | 144-145 | 2 | 1 |
| β-strand | 148-155 | 8 | 3 |
| β-strand | 161-163 | 3 | 3 |
| β-strand | 173 | 1 | 4 |
| β-strand | 182 | 1 | 4 |
| β-strand | 183-187 | 5 | 3 |
| α-helix | 188-189 | 2 | |
| α-helix | 193-194 | 2 | |
| α-helix | 197-206 | 10 | |
| β-strand | 209-213 | 5 | 1 |
| β-strand | 219-220 | 2 | 5 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-231 | 7 | |
| β-strand | 235-240 | 6 | 1 |
| β-strand | 252-255 | 4 | 1 |
| α-helix | 258-271 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-47 | 5 | 6 |
| α-helix | 50-53 | 4 | |
| α-helix | 57-59 | 3 | |
| β-strand | 62-63 | 2 | 7 |
| β-strand | 66-67 | 2 | 7 |
| β-strand | 70-71 | 2 | 7 |
| α-helix | 72-75 | 4 | |
| α-helix | 78-83 | 6 | |
| α-helix | 85-99 | 15 | |
| α-helix | 108-120 | 13 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-128 | 5 | 6 |
| α-helix | 134-138 | 5 | |
| β-strand | 144-145 | 2 | 6 |
| β-strand | 148-155 | 8 | 8 |
| β-strand | 161-163 | 3 | 8 |
| β-strand | 173 | 1 | 9 |
| β-strand | 182 | 1 | 9 |
| β-strand | 183-187 | 5 | 8 |
| α-helix | 188-189 | 2 | |
| α-helix | 193-194 | 2 | |
| α-helix | 197-206 | 10 | |
| β-strand | 209-213 | 5 | 6 |
| β-strand | 219-220 | 2 | 10 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-231 | 7 | |
| β-strand | 235-240 | 6 | 6 |
| α-helix | 247-249 | 3 | |
| β-strand | 252-255 | 4 | 6 |
| α-helix | 258-273 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-18 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NAD-dependent protein deacylase | A, B | protein | 254 | Escherichia coli (strain K12) | P75960 (AlphaFold model) |
| Histone H4 | C, D | protein | 11 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P02309 (AlphaFold model) |
>6RXP_1 NAD-dependent protein deacylase (chains A, B) MGSSHHHHHHSQDPKPRVLVLTGAGISAESGIRTFRAADGLWEEHRVEDVGTPEGFDRDP ELVQAFYNARRRQLQQPEIQPNAAHLALAKLQDALGDRFLLVTQNCDNLHERAGNTNVIH MHGELLKVRCSQSGQALDWTGDVTPEDKCHCCQFPAPLRPHVVWFGEMPLGMDEIYMALS MADIFIAIGTSGHVYPAAGFVHEAKLHGAHTVELNLEPSQVGNEFAEKYYGPASQVVPEF VEKLLKGLKAGSIA
>6RXP_2 Histone H4 (chains C, D) KGGAXRHRKIL
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Evolved, Selective Erasers of Distinct Lysine Acylations. Spinck, M., Neumann-Staubitz, P., Ecke, M. et al. Angew Chem Int Ed Engl (2020) 59:11142-11149. DOI 10.1002/anie.202002899 · PubMed
Other PDB entries of the same protein (UniProt P75960 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6RXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.