6RXQ: CobB Ac2
Crystal structure of CobB Ac2 (A76G,I131C,V162A) in complex with H4K16Cr-2'OH-ADPr peptide intermediate after soaking. Determined by X-ray diffraction at 1.7 Å resolution. Released 15 Apr 2020.
- Method
- X-ray diffraction
- Resolution
- 1.7 Å
- Organisms
- Escherichia coli (strain K12), Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
- Chains
- 8
- Atoms
- 8,315
- Mol. weight
- 119.75 kDa
- Ligands
- KMQ
- Released
- 15 Apr 2020
Explore 6RXQ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6RXQ contains 60 α-helices and 53 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 14 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 43-47 | 5 | 1 |
| α-helix | 50-53 | 4 | |
| β-strand | 66-67 | 2 | 2 |
| β-strand | 70-71 | 2 | 2 |
| α-helix | 72-75 | 4 | |
| α-helix | 78-83 | 6 | |
| α-helix | 85-99 | 15 | |
| α-helix | 108-120 | 13 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-128 | 5 | 1 |
| α-helix | 134-138 | 5 | |
| β-strand | 144-145 | 2 | 1 |
| β-strand | 148-155 | 8 | 3 |
| β-strand | 161-163 | 3 | 3 |
| β-strand | 183-187 | 5 | 3 |
| α-helix | 188-189 | 2 | |
| α-helix | 193-194 | 2 | |
| α-helix | 197-206 | 10 | |
| β-strand | 209-213 | 5 | 1 |
| β-strand | 219-220 | 2 | 4 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-231 | 7 | |
| β-strand | 235-240 | 6 | 1 |
| α-helix | 247-249 | 3 | |
| β-strand | 252-255 | 4 | 1 |
| α-helix | 258-273 | 16 | |
Chain B: 16 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-42 | 3 | |
| β-strand | 43-47 | 5 | 5 |
| α-helix | 49-51 | 3 | |
| α-helix | 53-55 | 3 | |
| β-strand | 66-67 | 2 | 6 |
| β-strand | 70-71 | 2 | 6 |
| α-helix | 72-75 | 4 | |
| α-helix | 78-83 | 6 | |
| α-helix | 85-99 | 15 | |
| α-helix | 108-120 | 13 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-128 | 5 | 5 |
| α-helix | 134-138 | 5 | |
| β-strand | 144-145 | 2 | 5 |
| β-strand | 148-155 | 8 | 7 |
| β-strand | 161-163 | 3 | 7 |
| β-strand | 183-187 | 5 | 7 |
| α-helix | 188-189 | 2 | |
| α-helix | 193-194 | 2 | |
| α-helix | 197-206 | 10 | |
| β-strand | 209-213 | 5 | 5 |
| β-strand | 219-220 | 2 | 8 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-231 | 7 | |
| β-strand | 235-240 | 6 | 5 |
| α-helix | 247-249 | 3 | |
| β-strand | 252-255 | 4 | 5 |
| α-helix | 258-273 | 16 | |
Chain C: 15 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 43-47 | 5 | 9 |
| α-helix | 49-51 | 3 | |
| α-helix | 53-55 | 3 | |
| β-strand | 66-67 | 2 | 10 |
| β-strand | 70-71 | 2 | 10 |
| α-helix | 72-75 | 4 | |
| α-helix | 78-83 | 6 | |
| α-helix | 85-99 | 15 | |
| α-helix | 108-120 | 13 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-128 | 5 | 9 |
| α-helix | 134-138 | 5 | |
| β-strand | 144-145 | 2 | 9 |
| β-strand | 148-155 | 8 | 11 |
| β-strand | 161-163 | 3 | 11 |
| β-strand | 183-187 | 5 | 11 |
| α-helix | 188-189 | 2 | |
| α-helix | 193-194 | 2 | |
| α-helix | 197-206 | 10 | |
| β-strand | 209-213 | 5 | 9 |
| β-strand | 219-220 | 2 | 12 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-231 | 7 | |
| β-strand | 235-240 | 6 | 9 |
| α-helix | 247-249 | 3 | |
| β-strand | 252-255 | 4 | 9 |
| α-helix | 258-273 | 16 | |
Chain D: 15 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 43-47 | 5 | 13 |
| α-helix | 49-51 | 3 | |
| α-helix | 53-55 | 3 | |
| β-strand | 61 | 1 | 14 |
| β-strand | 66-67 | 2 | 14 |
| β-strand | 70-71 | 2 | 14 |
| α-helix | 72-75 | 4 | |
| α-helix | 78-83 | 6 | |
| α-helix | 85-99 | 15 | |
| α-helix | 108-120 | 13 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-128 | 5 | 13 |
| α-helix | 134-138 | 5 | |
| β-strand | 144-145 | 2 | 13 |
| β-strand | 148-155 | 8 | 15 |
| β-strand | 161-163 | 3 | 15 |
| β-strand | 183-187 | 5 | 15 |
| α-helix | 188-189 | 2 | |
| α-helix | 193-194 | 2 | |
| α-helix | 197-206 | 10 | |
| β-strand | 209-213 | 5 | 13 |
| β-strand | 219-220 | 2 | 16 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-231 | 7 | |
| β-strand | 235-240 | 6 | 13 |
| α-helix | 247-249 | 3 | |
| β-strand | 252-255 | 4 | 13 |
| α-helix | 258-273 | 16 | |
Chains E, F, G and H: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 17-18 | 2 | 4 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| NAD-dependent protein deacylase | A, B, C, D | protein | 254 | Escherichia coli (strain K12) | P75960 (AlphaFold model) |
| Histone H4 | E, F, G, H | protein | 11 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P02309 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>6RXQ_1 NAD-dependent protein deacylase (chains A, B, C, D)
MGSSHHHHHHSQDPKPRVLVLTGAGISAESGIRTFRAADGLWEEHRVEDVGTPEGFDRDP
ELVQAFYNARRRQLQQPEIQPNAAHLALAKLQDALGDRFLLVTQNCDNLHERAGNTNVIH
MHGELLKVRCSQSGQALDWTGDVTPEDKCHCCQFPAPLRPHVVWFGEMPLGMDEIYMALS
MADIFIAIGTSGHVYPAAGFVHEAKLHGAHTVELNLEPSQVGNEFAEKYYGPASQVVPEF
VEKLLKGLKAGSIA
Sequence of entity 2 (E, F, G, H), FASTA
>6RXQ_2 Histone H4 (chains E, F, G, H)
KGGAKRHRKIL
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| KMQ | [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]… | C19 H29 N5 O14 P2 | 4 |
Primary citation
Evolved, Selective Erasers of Distinct Lysine Acylations. Spinck, M., Neumann-Staubitz, P., Ecke, M. et al. Angew Chem Int Ed Engl (2020) 59:11142-11149. DOI 10.1002/anie.202002899 · PubMed
Other PDB entries of the same protein (UniProt P75960 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6RXK 1.35 Å, Crystal structure of CobB wt in complex with H4K16-Butyryl peptide
- 6RXS 1.6 Å, Crystal structure of CobB Ac3(A76G,Y92A, I131L, V187Y) in complex with H4K16-Acetyl…
- 6RXJ 1.6 Å, Crystal structure of CobB wt in complex with H4K16-Acetyl peptide
- 6RXR 1.7 Å, Crystal structure of CobB Ac2 (A76G, I131C, V162G) in complex with H4K16Cr-2'OH-ADPr…
- 6RXP 1.8 Å, Crystal structure of CobB Ac2 (A76G,I131C,V162A) in complex with H4K16-Crotonyl peptide
- 6RXM 1.92 Å, Crystal structure of CobB Ac2 (A76G, I131C, V162G) in complex with H4K16-Acetyl peptide
- 6RXO 1.95 Å, Crystal structure of CobB Ac2 (A76G, I131C, V162A) in complex with H4K16-Buturyl peptide
- 1S5P 1.96 Å, Structure and substrate binding properties of cobB, a Sir2 homolog protein deacetylase…
- 6RXL 2.3 Å, Crystal structure of CobB wt in complex with H4K16-Crotonyl peptide
- 8ZSF 3.24 Å, CryoEM Helical Structure of KomC
Browse structure collections
About this viewer
MolViewer shows 6RXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.