Structure of Rib R28N from Streptococcus pyogenes. Determined by X-ray diffraction at 1.8 Å resolution. Released 11 Dec 2019.
Explore 6S5Z in 3D Show helices and sheets RCSB PDB PDBe
6S5Z contains 8 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 230-233 | 4 | |
| β-strand | 238 | 1 | 1 |
| β-strand | 241-244 | 4 | 2 |
| α-helix | 251-254 | 4 | |
| β-strand | 255 | 1 | 1 |
| α-helix | 258-260 | 3 | |
| β-strand | 266-269 | 4 | 2 |
| α-helix | 270 | 1 | |
| β-strand | 281-290 | 10 | 2 |
| β-strand | 296-306 | 11 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Surface protein R28 | A, B | protein | 85 | Streptococcus pyogenes | Q9XDB6 (AlphaFold model) |
>6S5Z_1 Surface protein R28 (chains A, B) SGAMDKIKYSPEAKHRTVEQHAELDAKDSIANTDELPSNSTYNWKNGHKPDTSTSGEKDG IVEVHYPDGTVDDVNVKVTVTSKKT
Defining the remarkable structural malleability of a bacterial surface protein Rib domain implicated in infection. Whelan, F., Lafita, A., Griffiths, S.C. et al. Proc Natl Acad Sci U S A (2019) 116:26540-26548. DOI 10.1073/pnas.1911776116 · PubMed
Other PDB entries of the same protein (UniProt Q9XDB6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6S5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.