8CXJ: The IgI3 domain of R28 protein from S. pyogenes

The IgI3 domain of R28 protein from S. pyogenes bound to CEACAM1. Determined by X-ray diffraction at 3.05 Å resolution. Released 15 Mar 2023.

Method: X-ray diffraction
Resolution: 3.05 Å
Organisms: Homo sapiens, Streptococcus pyogenes
Chains: 8
Atoms: 6,726
Mol. weight: 105.48 kDa
Released: 15 Mar 2023

Explore 8CXJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CXJ contains 24 α-helices and 84 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-11	2	2
β-strand	17-21	5	1
β-strand	28-35	8	3
α-helix	41-43	3
β-strand	44-49	6	3
β-strand	54-57	4	3
β-strand	65-67	3	1
β-strand	73-75	3	1
α-helix	80-82	3
β-strand	84-92	9	3
β-strand	97-104	8	3
β-strand	105-106	2	2

Chains B, D, F and H: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	16
β-strand	11-15	5	17
β-strand	20-27	8	16
β-strand	32-35	4	18
α-helix	37-42	6
α-helix	44-48	5
β-strand	52-59	8	16
β-strand	63-70	8	16
α-helix	75-77	3
β-strand	79-83	5	17
β-strand	84-87	4	18
β-strand	92	1	18
α-helix	93-95	3
β-strand	96-103	8	17

Chains C, E and G: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	4
β-strand	10-11	2	5
β-strand	17-22	6	4
β-strand	28-35	8	6
α-helix	41-43	3
β-strand	44-49	6	6
β-strand	54-57	4	6
β-strand	65-67	3	4
β-strand	73-75	3	4
α-helix	80-82	3
β-strand	84-92	9	6
β-strand	97-104	8	6
β-strand	105-106	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Carcinoembryonic antigen-related cell adhesion molecule 1	A, C, E, G	protein	109	Homo sapiens	P13688 (AlphaFold model)
Surface protein R28	B, D, F, H	protein	125	Streptococcus pyogenes	Q9XDB6 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>8CXJ_1 Carcinoembryonic antigen-related cell adhesion molecule 1 (chains A, C, E, G)
MAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPG
PANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY

Sequence of entity 2 (B, D, F, H), FASTA

>8CXJ_2 Surface protein R28 (chains B, D, F, H)
TAPTLTVTPEQQTVKVDEDITFTVTVEDENEVELGLDDLKAKYENDIIGARVKIKYLTKE
PNKKVMEVTIMKATLADKGAITFTAKDKAGNQAEPKTVTINVLPLKDSNEPKLPSTGGSH
HHHHH

Primary citation

Human CEACAM1 is targeted by a Streptococcus pyogenes adhesin implicated in puerperal sepsis pathogenesis. Catton, E.A., Bonsor, D.A., Herrera, C. et al. Nat Commun (2023) 14:2275-2275. DOI 10.1038/s41467-023-37732-1 · PubMed

Other PDB entries of the same protein (UniProt P13688 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MU8 1.7 Å, Structure of the minimally glycosylated human CEACAM1 N-terminal domain
6XO1 1.76 Å, Crystal structure of N97A mutant of human CEACAM1
23VF 1.79 Å, Crystal structure of CEACAM1 in complex with MG1124 antibody
6XNO 1.9 Å, Crystal structure of E99A mutant of human CEACAM1
6XNW 1.9 Å, Crystal structure of V39A mutant of human CEACAM1
4QXW 2.04 Å, Crystal structure of the human CEACAM1 membrane distal amino terminal (N)-domain
9U94 2.11 Å, Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM1
2GK2 2.2 Å, Crystal structure of the N terminal domain of human CEACAM1
7RPP 2.2 Å, Crystal structure of human CEACAM1 with GFCC' and ABED face
4WHD 2.5 Å, Human CEACAM1 N-domain homodimer
6GBH 2.59 Å, Helicobacter pylori adhesin HopQ type II bound to the N-terminal domain of human CEACAM1
6AW2 2.68 Å, Crystal structure of the HopQ-CEACAM1 complex

Browse structure collections

About this viewer

MolViewer shows 8CXJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.