6SCB: Chaperone protein IpgC

Name: PDB 6SCB: Crystal structure of a shortened IpgC variant with two bound Magnesium and two bound Chlorine atoms each
Published: 2020-09-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of a shortened IpgC variant with two bound Magnesium and two bound Chlorine atoms each. Determined by X-ray diffraction at 1.58 Å resolution. Released 9 Sept 2020.

Method: X-ray diffraction
Resolution: 1.58 Å
Organism: Shigella flexneri
Chains: 2
Atoms: 2,510
Mol. weight: 32.74 kDa
Ligands: MG
Released: 9 Sept 2020

Explore 6SCB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SCB contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	33-48	16
α-helix	52-65	14
α-helix	70-82	13
α-helix	86-100	15
α-helix	105-116	12
α-helix	120-133	14
α-helix	137-149	13

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	10-20	11
α-helix	33-48	16
α-helix	52-65	14
α-helix	70-82	13
α-helix	86-99	14
α-helix	105-116	12
α-helix	120-133	14
α-helix	137-149	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chaperone protein IpgC	A, B	protein	143	Shigella flexneri	P0A2U4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6SCB_1 Chaperone protein IpgC (chains A, B)
GSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFY
NVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFE
LVIQHSNDEKLKIKAQSYLDAIQ

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal structure of a shortened IpgC variant with two bound Magnesium and two bound Chlorine atoms each. Ley, M., Heine, A., Klebe, G. To be published.

Other PDB entries of the same protein (UniProt P0A2U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P42 1.5 Å, Crystal structure of IpgC in complex with a follow-up compound based on J2
7PE0 1.5 Å, Crystal structure of IpgC in complex with J52
7PEF 1.54 Å, Crystal structure of IpgC in complex with DMSO
7NRG 1.57 Å, Crystal structure of a shortened IpgC variant in complex with…
7O6S 1.58 Å, Crystal structure of a shortened IpgC variant in complex with…
7B1U 1.59 Å, Crystal structure of a shortened IpgC variant in complex with…
7NL8 1.59 Å, Crystal structure of a shortened IpgC variant in complex with 3-methylbenzohydrazide
7OWV 1.59 Å, Crystal structure of IpgC in complex with a follow-up compound based on J20
7AXY 1.63 Å, Crystal structure of a shortened IpgC variant in complex with…
7AZV 1.68 Å, Crystal structure of a shortened IpgC variant in complex with…
7O04 1.74 Å, Crystal structure of a shortened IpgC variant in complex with…
7AYW 1.78 Å, Crystal structure of a shortened IpgC variant in complex with 2H-isoindol-1-amine

Browse structure collections

About this viewer

MolViewer shows 6SCB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.