Crystal structure of a shortened IpgC variant in complex with N-(2H-1,3-benzodioxol-5-ylmethyl)cyclopentanamine. Determined by X-ray diffraction at 1.58 Å resolution. Released 20 Apr 2022.
Explore 7O6S in 3D Show helices and sheets RCSB PDB PDBe
7O6S contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-21 | 6 | |
| α-helix | 26-28 | 3 | |
| α-helix | 33-48 | 16 | |
| α-helix | 52-65 | 14 | |
| α-helix | 70-82 | 13 | |
| α-helix | 86-98 | 13 | |
| α-helix | 105-116 | 12 | |
| α-helix | 120-133 | 14 | |
| α-helix | 137-149 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-20 | 11 | |
| α-helix | 26-28 | 3 | |
| α-helix | 33-48 | 16 | |
| α-helix | 52-65 | 14 | |
| α-helix | 70-82 | 13 | |
| α-helix | 86-100 | 15 | |
| α-helix | 105-116 | 12 | |
| α-helix | 120-133 | 14 | |
| α-helix | 137-149 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chaperone protein IpgC | A, B | protein | 143 | Shigella flexneri | P0A2U4 (AlphaFold model) |
>7O6S_1 Chaperone protein IpgC (chains A, B) GSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFY NVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFE LVIQHSNDEKLKIKAQSYLDAIQ
Water and common crystallization additives (CL, DMS, PEG) are not listed.
Crystal structure of a shortened IpgC variant in complex with N-(2H-1,3-benzodioxol-5-ylmethyl)cyclopentanamine. Gardonyi, M., Heine, A., Klebe, G. To be published.
Other PDB entries of the same protein (UniProt P0A2U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7O6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.