Crystal structure of PDZ1-2 from PSD-95 with peptide ligand sequence RRESEI bound to both domains. Determined by X-ray diffraction at 2.08 Å resolution. Released 2 Oct 2019.
Explore 6SPZ in 3D Show helices and sheets RCSB PDB PDBe
6SPZ contains 6 α-helices and 20 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 61-69 | 9 | 1 |
| β-strand | 71 | 1 | 2 |
| β-strand | 74 | 1 | 2 |
| β-strand | 77-81 | 5 | 1 |
| β-strand | 94-99 | 6 | 1 |
| α-helix | 104-108 | 5 | |
| α-helix | 115 | 1 | |
| β-strand | 116-120 | 5 | 1 |
| β-strand | 123-124 | 2 | 1 |
| α-helix | 130-138 | 9 | |
| β-strand | 143-151 | 9 | 1 |
| α-helix | 152-156 | 5 | |
| β-strand | 157-164 | 8 | 3 |
| β-strand | 166 | 1 | 4 |
| β-strand | 169 | 1 | 4 |
| β-strand | 172-176 | 5 | 3 |
| β-strand | 183 | 1 | 5 |
| β-strand | 186 | 1 | 5 |
| β-strand | 189-194 | 6 | 3 |
| α-helix | 199-203 | 5 | |
| β-strand | 211-215 | 5 | 3 |
| β-strand | 218-219 | 2 | 3 |
| α-helix | 225-233 | 9 | |
| β-strand | 238-245 | 8 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 424-425 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Disks large homolog 4 | A | protein | 197 | Homo sapiens | P78352 (AlphaFold model) |
| Arg-arg-glu-ser-glu-ile | P, Q | protein | 6 | Homo sapiens | P63252 (AlphaFold model) |
>6SPZ_1 Disks large homolog 4 (chains A) GPNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLR VNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGF SIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAAL KNTYDVVYLKVAKPSNA
>6SPZ_2 ARG-ARG-GLU-SER-GLU-ILE (chains P, Q) RRESEI
| ID | Name | Formula | Copies |
|---|---|---|---|
| GSH | Glutathione | C10 H17 N3 O6 S | 1 |
The Dual PDZ Domain from Postsynaptic Density Protein 95 Forms a Scaffold with Peptide Ligand. Rodzli, N.A., Lockhart-Cairns, M.P., Levy, C.W. et al. Biophys J (2020) 119:667-689. DOI 10.1016/j.bpj.2020.06.018 · PubMed
Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6SPZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.