6SPZ: Disks large homolog 4

Crystal structure of PDZ1-2 from PSD-95 with peptide ligand sequence RRESEI bound to both domains. Determined by X-ray diffraction at 2.08 Å resolution. Released 2 Oct 2019.

Method: X-ray diffraction
Resolution: 2.08 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,655
Mol. weight: 22.76 kDa
Ligands: GSH
Released: 2 Oct 2019

Explore 6SPZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SPZ contains 6 α-helices and 20 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	61-69	9	1
β-strand	71	1	2
β-strand	74	1	2
β-strand	77-81	5	1
β-strand	94-99	6	1
α-helix	104-108	5
α-helix	115	1
β-strand	116-120	5	1
β-strand	123-124	2	1
α-helix	130-138	9
β-strand	143-151	9	1
α-helix	152-156	5
β-strand	157-164	8	3
β-strand	166	1	4
β-strand	169	1	4
β-strand	172-176	5	3
β-strand	183	1	5
β-strand	186	1	5
β-strand	189-194	6	3
α-helix	199-203	5
β-strand	211-215	5	3
β-strand	218-219	2	3
α-helix	225-233	9
β-strand	238-245	8	3

Chains P and Q: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	424-425	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4	A	protein	197	Homo sapiens	P78352 (AlphaFold model)
Arg-arg-glu-ser-glu-ile	P, Q	protein	6	Homo sapiens	P63252 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SPZ_1 Disks large homolog 4 (chains A)
GPNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLR
VNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGF
SIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAAL
KNTYDVVYLKVAKPSNA

Sequence of entity 2 (P, Q), FASTA

>6SPZ_2 ARG-ARG-GLU-SER-GLU-ILE (chains P, Q)
RRESEI

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	1

Primary citation

The Dual PDZ Domain from Postsynaptic Density Protein 95 Forms a Scaffold with Peptide Ligand. Rodzli, N.A., Lockhart-Cairns, M.P., Levy, C.W. et al. Biophys J (2020) 119:667-689. DOI 10.1016/j.bpj.2020.06.018 · PubMed

Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TNG 0.95 Å, Crystal Structure of the third PDZ domain of PSD-95 protein E401R mutant
6QJL 1.04 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P21
6QJK 1.05 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
8AH5 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
8AH7 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
3I4W 1.35 Å, Crystal Structure of the third PDZ domain of PSD-95
3K82 1.4 Å, Crystal Structure of the third PDZ domain of PSD-95
9TNF 1.45 Å, Crystal Structure of the third PDZ domain of PSD-95 protein Y397E mutant
8AH4 1.48 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3112 at…
6QJF 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332P mutant: space group…
6QJI 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein: space group P3112
8AH8 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3121 at…

Browse structure collections

About this viewer

MolViewer shows 6SPZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.