Crystal structure of the Cyclic Nucleotide-Binding Homology Domain of the human KCNH2 channel. Determined by X-ray diffraction at 1.5 Å resolution. Released 4 Mar 2020.
Explore 6SYG in 3D Show helices and sheets RCSB PDB PDBe
6SYG contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 731-737 | 7 | |
| α-helix | 740-743 | 4 | |
| α-helix | 748-757 | 10 | |
| β-strand | 759-763 | 5 | 1 |
| α-helix | 764 | 1 | |
| β-strand | 768-770 | 3 | 2 |
| β-strand | 775 | 1 | 3 |
| β-strand | 778-784 | 7 | 1 |
| β-strand | 787-791 | 5 | 2 |
| β-strand | 794-799 | 6 | 2 |
| β-strand | 804-806 | 3 | 1 |
| β-strand | 817 | 1 | 3 |
| β-strand | 818 | 1 | 4 |
| β-strand | 821-824 | 4 | 2 |
| β-strand | 828-834 | 7 | 1 |
| α-helix | 835-843 | 9 | |
| α-helix | 846-855 | 10 | |
| β-strand | 860-861 | 2 | 1 |
| β-strand | 863 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Potassium voltage-gated channel subfamily H member 2 | A | protein | 135 | Homo sapiens | O08962 (AlphaFold model) |
>6SYG_1 Potassium voltage-gated channel subfamily H member 2 (chains A) GAMGRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEI LRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFS DHFWSSLEITFNLRD
Structure of KCNH2 cyclic nucleotide-binding homology domain reveals a functionally vital salt-bridge. Ben-Bassat, A., Giladi, M., Haitin, Y. J Gen Physiol (2020) 152. DOI 10.1085/jgp.201912505 · PubMed
MolViewer shows 6SYG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.