ROR(gamma)t ligand binding domain in complex with 20-alpha-hydroxycholesterol and allosteric ligand FM26. Determined by X-ray diffraction at 1.62 Å resolution. Released 18 Nov 2020.
Explore 6T4T in 3D Show helices and sheets RCSB PDB PDBe
6T4T contains 17 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 269-284 | 16 | |
| α-helix | 289-294 | 6 | |
| α-helix | 295-297 | 3 | |
| β-strand | 299 | 1 | 1 |
| α-helix | 302-310 | 9 | |
| α-helix | 313-337 | 25 | |
| α-helix | 341-343 | 3 | |
| α-helix | 346-364 | 19 | |
| α-helix | 365-368 | 4 | |
| β-strand | 369-370 | 2 | 1 |
| β-strand | 375-378 | 4 | 1 |
| β-strand | 381-384 | 4 | 1 |
| α-helix | 385-391 | 7 | |
| α-helix | 394-408 | 15 | |
| α-helix | 414-425 | 12 | |
| α-helix | 436-456 | 21 | |
| α-helix | 460-465 | 6 | |
| α-helix | 467-468 | 2 | |
| α-helix | 469-489 | 21 | |
| α-helix | 491-493 | 3 | |
| α-helix | 499-505 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear receptor ROR-gamma | A | protein | 241 | Homo sapiens | P51449 (AlphaFold model) |
>6T4T_1 Nuclear receptor ROR-gamma (chains A) LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTE AIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGME LFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNL ELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF S
| ID | Name | Formula | Copies |
|---|---|---|---|
| HCD | (3alpha,8alpha)-cholest-5-ene-3,20-diol | C27 H46 O2 | 1 |
| L3E | 4-[(~{E})-[3-[2-chloranyl-6-(trifluoromethyl)phenyl]-5-(1~{H}-pyrrol-3-yl)-1,2-… | C22 H13 Cl F3 N3 O3 | 1 |
Water and common crystallization additives (GOL) are not listed.
Cooperativity between the orthosteric and allosteric ligand binding sites of ROR gamma t. de Vries, R.M.J.M., Meijer, F.A., Doveston, R.G. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2021287118 · PubMed
Other PDB entries of the same protein (UniProt P51449 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6T4T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.