Crystal structure of the Orexin-1 receptor in complex with lemborexant. Determined by X-ray diffraction at 2.22 Å resolution. Released 15 Jan 2020.
Explore 6TOT in 3D Show helices and sheets RCSB PDB PDBe
6TOT contains 32 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 28-35 | 8 | |
| α-helix | 36-40 | 5 | |
| α-helix | 41-73 | 33 | |
| α-helix | 75-77 | 3 | |
| α-helix | 80-94 | 15 | |
| α-helix | 95-99 | 5 | |
| α-helix | 100-109 | 10 | |
| α-helix | 115-148 | 34 | |
| α-helix | 158-175 | 18 | |
| α-helix | 177-182 | 6 | |
| β-strand | 183-186 | 4 | 1 |
| β-strand | 201-204 | 4 | 1 |
| α-helix | 210-220 | 11 | |
| α-helix | 221-225 | 5 | |
| α-helix | 226-242 | 17 | |
| α-helix | 287-322 | 36 | |
| α-helix | 333-361 | 29 | |
| α-helix | 363-375 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 46-73 | 28 | |
| α-helix | 75-77 | 3 | |
| α-helix | 80-94 | 15 | |
| α-helix | 95-99 | 5 | |
| α-helix | 100-109 | 10 | |
| α-helix | 115-148 | 34 | |
| α-helix | 158-175 | 18 | |
| α-helix | 177-182 | 6 | |
| β-strand | 183-187 | 5 | 2 |
| α-helix | 190-194 | 5 | |
| β-strand | 200-204 | 5 | 2 |
| α-helix | 210-220 | 11 | |
| α-helix | 221-225 | 5 | |
| α-helix | 226-242 | 17 | |
| α-helix | 245-247 | 3 | |
| α-helix | 252-322 | 39 | |
| α-helix | 333-361 | 29 | |
| α-helix | 363-376 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Orexin receptor type 1 | A, B | protein | 336 | Homo sapiens | O43613 (AlphaFold model) |
>6TOT_1 Orexin receptor type 1 (chains A, B) AASEDEFLRYLWRDYLYPKQYAWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYF LVNLSLADVLATAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDR WYAICHPLLFKSTARRALGSILGIWAVSLAIMVPQAAVMECSSVLPELAARTRAFSVCDE RWADDLAPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSAEVKQMRARRKT AKMLMVVVLVFALCYLPISVLNVLKRVFGMFRQASDREAVYAAFTFSHWLVYANSAANPI IYNFLSGKFREQFKAAFSWWLPGLAAAHHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| PGW | (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexade… | C40 H77 O10 P | 2 |
| SOG | octyl 1-thio-beta-D-glucopyranoside | C14 H28 O5 S | 9 |
| NRK | (1~{R},2~{S})-2-[(2,4-dimethylpyrimidin-5-yl)oxymethyl]-~{N}-(5-fluoranylpyridi… | C22 H20 F2 N4 O2 | 2 |
Water and common crystallization additives (SO4, PG4) are not listed.
Comparison of Orexin 1 and Orexin 2 Ligand Binding Modes Using X-ray Crystallography and Computational Analysis. Rappas, M., Ali, A.A.E., Bennett, K.A. et al. J Med Chem (2020) 63:1528-1543. DOI 10.1021/acs.jmedchem.9b01787 · PubMed
Other PDB entries of the same protein (UniProt O43613 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6TOT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.