6TXQ: FERM domain and helical linker of human moesin

The high resolution structure of the FERM domain and helical linker of human moesin. Determined by X-ray diffraction at 1.73 Å resolution. Released 29 Jan 2020.

Method: X-ray diffraction
Resolution: 1.73 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,879
Mol. weight: 41.2 kDa
Released: 29 Jan 2020

Explore 6TXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TXQ contains 15 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	15-20	6	1
β-strand	25	1	2
α-helix	26-37	12
α-helix	42-44	3
β-strand	45-50	6	1
β-strand	56-58	3	1
α-helix	59-60	2
β-strand	64	1	2
α-helix	65-67	3
β-strand	76-82	7	1
α-helix	89-92	4
α-helix	96-111	16
α-helix	119-134	16
α-helix	155-159	5
α-helix	165-178	14
α-helix	184-195	12
α-helix	203	1
β-strand	204-209	6	3
β-strand	215-220	6	3
β-strand	224-229	6	3
β-strand	238-241	4	3
α-helix	242-244	3
β-strand	245-251	7	3
β-strand	254-259	6	3
α-helix	265-266	2
β-strand	267-270	4	3
α-helix	274-293	20
α-helix	300-326	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Moesin	AAA	protein	347	Homo sapiens	P26038 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>6TXQ_1 Moesin (chains AAA)
SMPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWL
KLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPP
ETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEH
RGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIG
FPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT
IEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEE

Primary citation

Discovery of FERM domain protein-protein interaction inhibitors for MSN and CD44 as a potential therapeutic approach for Alzheimer's disease. Du, Y., Bradshaw, W.J., Leisner, T.M. et al. J Biol Chem (2023) 299:105382-105382. DOI 10.1016/j.jbc.2023.105382 · PubMed

Other PDB entries of the same protein (UniProt P26038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CIS 1.52 Å, The FERM domain of human moesin with two bound peptides identified by phage display
8XZ5 1.8 Å, SARS-CoV-2 S and moesin complex structure
8CIR 1.85 Å, The FERM domain of human moesin with a bound peptide identified by phage display
1EF1 1.9 Å, Crystal structure of the moesin ferm domain/tail domain complex
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
8CIU 2.39 Å, The FERM domain of human moesin mutant H288A
8CIT 2.54 Å, The FERM domain of human moesin mutant L281R
1E5W 2.7 Å, Structure of isolated FERM domain and first long helix of moesin
1SGH 3.5 Å, Moesin FERM domain bound to EBP50 C-terminal peptide

Browse structure collections

About this viewer

MolViewer shows 6TXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.