8XZ5: SARS-CoV-2 S and moesin complex structure

SARS-CoV-2 S and moesin complex structure. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Oct 2025.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 2,691
Mol. weight: 36.46 kDa
Released: 8 Oct 2025

Explore 8XZ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XZ5 contains 11 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	14-20	7	1
β-strand	25	1	2
α-helix	26-37	12
α-helix	42-44	3
β-strand	45-50	6	1
β-strand	51	1	3
β-strand	56-58	3	1
β-strand	64	1	2
β-strand	70	1	3
β-strand	76-82	7	1
α-helix	89-92	4
α-helix	96-111	16
α-helix	119-134	16
α-helix	155-159	5
α-helix	165-178	14
α-helix	184-195	12
β-strand	204-210	7	4
β-strand	215-221	7	4
β-strand	224-229	6	4
β-strand	236-241	6	4
α-helix	242-244	3
β-strand	245-251	7	4
β-strand	254-259	6	4
α-helix	265-266	2
β-strand	267-270	4	4
α-helix	274-294	21

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1264-1270	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Moesin	A	protein	296	Homo sapiens	P26038 (AlphaFold model)
Spike protein S2'	B	protein	14	Severe acute respiratory syndrome coronavirus 2	P0DTC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8XZ5_1 Moesin (chains A)
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK

Sequence of entity 2 (B), FASTA

>8XZ5_2 Spike protein S2' (chains B)
DSEPVLKGVKLHYT

Primary citation

SARS-CoV-2 S assembly into virions facilitated by host ERM proteins. Wang, J., Tai, W., Wang, Z. et al. Proc Natl Acad Sci U S A (2026) 123:e2504517123-e2504517123. DOI 10.1073/pnas.2504517123 · PubMed

Other PDB entries of the same protein (UniProt P26038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CIS 1.52 Å, The FERM domain of human moesin with two bound peptides identified by phage display
6TXQ 1.73 Å, The high resolution structure of the FERM domain and helical linker of human moesin
8CIR 1.85 Å, The FERM domain of human moesin with a bound peptide identified by phage display
1EF1 1.9 Å, Crystal structure of the moesin ferm domain/tail domain complex
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
8CIU 2.39 Å, The FERM domain of human moesin mutant H288A
8CIT 2.54 Å, The FERM domain of human moesin mutant L281R
1E5W 2.7 Å, Structure of isolated FERM domain and first long helix of moesin
1SGH 3.5 Å, Moesin FERM domain bound to EBP50 C-terminal peptide

Browse structure collections

About this viewer

MolViewer shows 8XZ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.