6TYV: Ku80 von Willebrand domain

Structure of Ku80 von Willebrand domain complexed with WRN Ku Binding Motif. Determined by X-ray diffraction at 1.93 Å resolution. Released 27 Nov 2019.

Method: X-ray diffraction
Resolution: 1.93 Å
Organisms: Xenopus laevis, Homo sapiens
Chains: 2
Atoms: 1,807
Mol. weight: 28.12 kDa
Released: 27 Nov 2019

Explore 6TYV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TYV contains 10 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	1
α-helix	17-20	4
α-helix	29-46	18
β-strand	52-58	7	1
β-strand	64	1	1
β-strand	76-83	8	1
α-helix	87-95	9
α-helix	106-120	15
β-strand	129-134	6	1
β-strand	142	1	2
α-helix	146-155	10
β-strand	158-164	7	1
α-helix	198-215	18
α-helix	216-222	7
β-strand	223-225	3	1
α-helix	226-228	3
α-helix	229-234	6

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9	1	2
α-helix	17-19	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
X-ray repair cross-complementing protein 5	A	protein	231	Xenopus laevis	Q6DDS9 (AlphaFold model)
Thr-thr-ala-gln-gln-arg-lys-cys-pro-glu-trp-met-asn	B	protein	16	Homo sapiens	Q14191 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6TYV_1 X-ray repair cross-complementing protein 5 (chains A)
MHHHHHHMARAAKSAVVLCMDVGLAMSHSNQGKESPFEQAKKVMMLFLQRQVFAESKDEI
AVVLYGTDTTDNALAREDQYENISVHRHLMLPDFDLLEQIENVVEPGSVQADFLDALIVS
MDLLQKETLGKKYTRLHIAVFSDLSSPFSVDQLEVIIANLKKAEITLQFFLPFSVDEGSG
PGKGLSDQQKEGIEMVRKIMFSLDGEEGLSEVFTFRDSLERLSIFKKIERR

Sequence of entity 2 (B), FASTA

>6TYV_2 THR-THR-ALA-GLN-GLN-ARG-LYS-CYS-PRO-GLU-TRP-MET-ASN (chains B)
TTAQQRKCPEWMNVQN

Primary citation

Ligand binding characteristics of the Ku80 von Willebrand domain. Kim, K., Min, J., Kirby, T.W. et al. DNA Repair (Amst) (2019) 85:102739-102739. DOI 10.1016/j.dnarep.2019.102739 · PubMed

Other PDB entries of the same protein (UniProt Q6DDS9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TYU 1.47 Å, Structure of Ku80 von Willebrand domain complexed with MRI Ku Binding Motif
6TYZ 1.51 Å, Structure of Ku80 von Willebrand domain complexed with APLF Ku Binding Motif
6TYW 1.7 Å, Structure of Ku80 von Willebrand domain S229A mutant complexed with APLF Ku Binding Motif
6TYX 1.9 Å, Structure of Ku80 von Willebrand domain S229A mutant complexed with XLF Ku Binding Motif
6TYT 2.4 Å, Structure of Ku80 von Willebrand domain S229A mutant complexed with APLF and XLF Ku…

Browse structure collections

About this viewer

MolViewer shows 6TYV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.