6U2U: DNA-binding protein inhibitor ID-1

Helix-Loop-helix motif of mouse DNA-binding protein inhibitor ID-1. Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Oct 2019.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Mus musculus
Chains: 2
Atoms: 835
Mol. weight: 10.91 kDa
Released: 16 Oct 2019

Explore 6U2U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6U2U contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	62-72	11
α-helix	84-102	19

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	62-72	11
α-helix	84-101	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-binding protein inhibitor ID-1	A, B	protein	46	Mus musculus	P20067 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6U2U_1 DNA-binding protein inhibitor ID-1 (chains A, B)
LYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNS

Primary citation

A Small-Molecule Pan-Id Antagonist Inhibits Pathologic Ocular Neovascularization. Wojnarowicz, P.M., Lima E Silva, R., Ohnaka, M. et al. Cell Rep (2019) 29:62-75.e7. DOI 10.1016/j.celrep.2019.08.073 · PubMed

Other PDB entries of the same protein (UniProt P20067 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MGM 1.79 Å, Helix-Loop-helix motif of mouse DNA-binding protein inhibitor ID-1
6MGN 1.9 Å, mouse Id1 (51-104) - human hE47 (348-399) complex

Browse structure collections

About this viewer

MolViewer shows 6U2U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.