6MGN: Transcription factor E2-alpha

mouse Id1 (51-104) - human hE47 (348-399) complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Sept 2019.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 984
Mol. weight: 11.73 kDa
Released: 18 Sept 2019

Explore 6MGN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MGN contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	562-577	16
α-helix	585-606	22

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	62-72	11
α-helix	84-102	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor E2-alpha	A	protein	52	Homo sapiens	P15923 (AlphaFold model)
DNA-binding protein inhibitor ID-1	B	protein	47	Mus musculus	P20067 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MGN_1 Transcription factor E2-alpha (chains A)
RVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLN

Sequence of entity 2 (B), FASTA

>6MGN_2 DNA-binding protein inhibitor ID-1 (chains B)
MLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNS

Primary citation

A Small-Molecule Pan-Id Antagonist Inhibits Pathologic Ocular Neovascularization. Wojnarowicz, P.M., Lima E Silva, R., Ohnaka, M. et al. Cell Rep (2019) 29:62-75.e7. DOI 10.1016/j.celrep.2019.08.073 · PubMed

Other PDB entries of the same protein (UniProt P15923 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U5V 1.7 Å, Crystal structure of Max-E47
2YPA 2.8 Å, Structure of the SCL:E47:LMO2:LDB1 complex bound to DNA
2YPB 2.87 Å, Structure of the SCL:E47 complex bound to DNA
2MH0 Solution NMR structure of the p300 Taz2:ETAD1 complex

Browse structure collections

About this viewer

MolViewer shows 6MGN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.