6UCH: PDB entry 6UCH

SMARCB1 nucleosome-interacting C-terminal alpha helix. Determined by solution NMR. Released 27 Nov 2019.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 329
Mol. weight: 4.75 kDa
Released: 27 Nov 2019

Explore 6UCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UCH contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	358-377	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1	A	protein	41	Homo sapiens	Q12824 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6UCH_1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (chains A)
GPLGSMPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW

Primary citation

Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Valencia, A.M., Collings, C.K., Dao, H.T. et al. Cell (2019) 179:1342-1356.e23. DOI 10.1016/j.cell.2019.10.044 · PubMed

Other PDB entries of the same protein (UniProt Q12824 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJK 2.05 Å, Crystal Structure of BAF47 and BAF155 Complex
5L7A 2.1 Å, The crystal structure of the Human SNF5/INI1 domain
6KZ7 2.28 Å, The crystal structure of BAF155 SWIRM domain and N-terminal elongated hSNF5 RPT1 domain…
6KAG 2.6 Å, Crystal structure of the SMARCB1/SMARCC2 subcomplex
6LTH 3.0 Å, Structure of human BAF Base module
7VDV 3.4 Å, The overall structure of human chromatin remodeling PBAF-nucleosome complex
9RL4 3.5 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6
6LTJ 3.7 Å, Structure of nucleosome-bound human BAF complex
9RN2 4.1 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2
9RMC 4.2 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1
7Y8R 4.4 Å, The nucleosome-bound human PBAF complex
9RN1 5.9 Å, Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47…

Browse structure collections

About this viewer

MolViewer shows 6UCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.