6UEW: PDB entry 6UEW

Rubisco / CsoS2 N-peptide complex responsible for alpha-carboxysome cargo loading. Determined by X-ray diffraction at 2.4 Å resolution. Released 30 Oct 2019.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Halothiobacillus neapolitanus (strain ATCC 23641 / c2), Halothiobacillus neapolitanus c2
Chains: 8
Atoms: 18,304
Mol. weight: 276.63 kDa
Released: 30 Oct 2019

Explore 6UEW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UEW contains 127 α-helices and 104 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
β-strand	18	1	1
β-strand	23	1	2
β-strand	29-37	9	1
α-helix	43-53	11
α-helix	63-66	4
β-strand	76-83	8	1
β-strand	86-96	11	1
α-helix	98-100	3
α-helix	106-114	9
α-helix	117-119	3
β-strand	123-132	10	1
α-helix	135-138	4
α-helix	148-155	8
β-strand	162-166	5	3
α-helix	175-187	13
β-strand	192-194	3	3
β-strand	202	1	4
β-strand	205	1	4
α-helix	207-225	19
β-strand	230-234	5	3
α-helix	240-253	14
β-strand	257-261	5	3
α-helix	262-265	4
α-helix	267-280	14
β-strand	283-287	5	3
α-helix	291-295	5
β-strand	301-302	2	1
α-helix	304-314	11
β-strand	318-320	3	3
α-helix	333-343	11
β-strand	346-347	2	5
β-strand	350	1	6
α-helix	351-353	3
β-strand	355	1	6
β-strand	359-360	2	5
α-helix	364-366	3
β-strand	368-371	4	3
α-helix	377-379	3
α-helix	380-387	8
β-strand	391-395	5	3
α-helix	397-400	4
α-helix	406-425	20
α-helix	434-442	9
α-helix	446-454	9
α-helix	477-490	14
β-strand	491	1	7

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
α-helix	24-36	13
β-strand	40-47	8	8
α-helix	48-50	3
α-helix	56	1
β-strand	57-58	2	8
α-helix	69-82	14
β-strand	86-94	9	8
β-strand	99-107	9	8

Chain C: 27 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
β-strand	18	1	9
α-helix	22	1
β-strand	23	1	7
α-helix	24-25	2
β-strand	29-37	9	9
α-helix	43-53	11
α-helix	65-67	3
β-strand	76-83	8	9
β-strand	86-96	11	9
α-helix	98-100	3
α-helix	106-114	9
α-helix	117-119	3
β-strand	123-132	10	9
α-helix	135-138	4
α-helix	148-155	8
β-strand	162-166	5	10
α-helix	175-188	14
β-strand	192-194	3	10
β-strand	202	1	11
β-strand	205	1	11
α-helix	207-225	19
β-strand	230-234	5	10
α-helix	240-252	13
β-strand	257-261	5	10
α-helix	262-265	4
α-helix	267-280	14
β-strand	283-287	5	10
α-helix	291-295	5
β-strand	301-302	2	9
α-helix	304-314	11
β-strand	318-320	3	10
α-helix	333-343	11
β-strand	346-347	2	12
β-strand	350	1	13
α-helix	351-353	3
β-strand	355	1	13
β-strand	359-360	2	12
α-helix	364-366	3
β-strand	368-371	4	10
α-helix	377-379	3
α-helix	380-387	8
β-strand	391-395	5	10
α-helix	397-400	4
α-helix	406-425	20
α-helix	434-442	9
α-helix	446-454	9
α-helix	476-490	15
β-strand	491	1	2

Chain D: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	20-23	4
α-helix	24-36	13
α-helix	39	1
β-strand	40-46	7	14
α-helix	48-50	3
α-helix	56	1
β-strand	57-58	2	14
α-helix	69-82	14
β-strand	87-94	8	14
β-strand	99-107	9	14

Chain E: 27 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
β-strand	18	1	15
α-helix	22	1
β-strand	23	1	16
α-helix	24-25	2
β-strand	29-37	9	15
α-helix	43-53	11
α-helix	65-67	3
β-strand	76-82	7	15
β-strand	90-96	7	15
α-helix	98-100	3
α-helix	106-114	9
α-helix	117-119	3
β-strand	123-132	10	15
α-helix	135-138	4
α-helix	148-155	8
β-strand	162-166	5	17
α-helix	175-188	14
β-strand	192-194	3	17
β-strand	202	1	18
β-strand	205	1	18
α-helix	207-225	19
β-strand	230-234	5	17
α-helix	240-253	14
β-strand	257-261	5	17
α-helix	262-265	4
α-helix	267-280	14
β-strand	283-287	5	17
α-helix	291-295	5
β-strand	301-302	2	15
α-helix	304-314	11
β-strand	318-320	3	17
α-helix	334-343	10
β-strand	346-347	2	19
β-strand	350	1	20
α-helix	351-353	3
β-strand	355	1	20
β-strand	359-360	2	19
α-helix	364-366	3
β-strand	368-371	4	17
α-helix	377-379	3
α-helix	380-387	8
β-strand	391-394	4	17
α-helix	397-400	4
α-helix	406-426	21
α-helix	434-441	8
α-helix	446-454	9
α-helix	477-490	14
β-strand	491	1	21

Chain F: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	20-21	2
α-helix	25-36	12
β-strand	40-46	7	22
α-helix	48-50	3
α-helix	56	1
β-strand	57-59	3	22
α-helix	69-82	14
β-strand	87-94	8	22
β-strand	99-107	9	22

Chain G: 25 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
β-strand	18	1	23
β-strand	23	1	21
β-strand	29-37	9	23
α-helix	43-53	11
α-helix	63-67	5
β-strand	76-83	8	23
β-strand	86-96	11	23
α-helix	98-100	3
α-helix	106-114	9
α-helix	117-119	3
β-strand	123-132	10	23
α-helix	135-138	4
α-helix	148-155	8
β-strand	162-166	5	24
α-helix	175-188	14
β-strand	192-194	3	24
β-strand	202	1	25
β-strand	205	1	25
α-helix	207-225	19
β-strand	230-234	5	24
α-helix	240-253	14
β-strand	257-261	5	24
α-helix	262-265	4
α-helix	267-280	14
β-strand	283-287	5	24
α-helix	292-295	4
β-strand	301-302	2	23
α-helix	304-314	11
β-strand	318-320	3	24
α-helix	333-343	11
β-strand	346-347	2	26
β-strand	350	1	27
α-helix	351-353	3
β-strand	355	1	27
β-strand	359-360	2	26
α-helix	364-366	3
β-strand	368-371	4	24
α-helix	377-379	3
α-helix	380-387	8
β-strand	391-395	5	24
α-helix	397-400	4
α-helix	406-426	21
α-helix	434-442	9
α-helix	446-452	7
α-helix	477-490	14
β-strand	491	1	16

Chain H: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	20-22	3
α-helix	24-36	13
β-strand	40-46	7	28
α-helix	48-50	3
α-helix	56	1
β-strand	57-59	3	28
α-helix	69-82	14
β-strand	87-94	8	28
β-strand	99-105	7	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribulose bisphosphate carboxylase large chain, CsoS2 N-peptide fusion	A, C, E, G	protein	506	Halothiobacillus neapolitanus (strain ATCC 23641 / c2), Halothiobacillus neapolitanus c2	O85040 (AlphaFold model)
Ribulose bisphosphate carboxylase small chain	B, D, F, H	protein	110	Halothiobacillus neapolitanus (strain ATCC 23641 / c2)	P45686 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>6UEW_1 Ribulose bisphosphate carboxylase large chain, CsoS2 N-peptide fusion (chains A, C, E, G)
MSAVKKYSAGVKEYRQTYWMPEYTPLDSDILACFKITPQPGVDREEAAAAVAAESSTGTW
TTVWTDLLTDMDYYKGRAYRIEDVPGDDAAFYAFIAYPIDLFEEGSVVNVFTSLVGNVFG
FKAVRGLRLEDVRFPLAYVKTCGGPPHGIQVERDKMNKYGRPLLGCTIKPKLGLSAKNYG
RAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQDATETAEAQTGERKGHYLNVTAPT
PEEMYKRAEFAKEIGAPIIMHDYITGGFTANTGLAKWCQDNGVLLHIHRAMHAVIDRNPN
HGIHFRVLTKILRLSGGDHLHTGTVVGKLEGDRASTLGWIDLLRESFIPEDRSRGIFFDQ
DWGSMPGVFAVASGGIHVWHMPALVNIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEA
CVEARNQGRDIEKEGKEILTAAAQHSPELKIAMETWKEIKFEFDTVDKLDTQNRSSGRDL
ARARREALSQQGKAAVGSWSHPQFEK

Sequence of entity 2 (B, D, F, H), FASTA

>6UEW_2 Ribulose bisphosphate carboxylase small chain (chains B, D, F, H)
MAEMQDYKQSLKYETFSYLPPMNAERIRAQIKYAIAQGWSPGIEHVEVKNSMNQYWYMWK
LPFFGEQNVDNVLAEIEACRSAYPTHQVKLVAYDNYAQSLGLAFVVYRGN

Primary citation

Multivalent interactions between CsoS2 and Rubisco mediate alpha-carboxysome formation. Oltrogge, L.M., Chaijarasphong, T., Chen, A.W. et al. Nat Struct Mol Biol (2020) 27:281-287. DOI 10.1038/s41594-020-0387-7 · PubMed

Other PDB entries of the same protein (UniProt O85040 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SVD 1.8 Å, The structure of Halothiobacillus neapolitanus RuBisCo
7SMK 1.98 Å, H. neapolitanus carboxysomal rubisco/CsoSCA-peptide (1-50)complex
7SNV 2.07 Å, H. neapolitanus carboxysomal rubisco/CsoSCA-peptide (1-50)complex
7ZBT 3.3 Å, Subtomogram averaging of Rubisco from native Halothiobacillus carboxysomes

Browse structure collections

About this viewer

MolViewer shows 6UEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.