7ZBT: Ribulose bisphosphate carboxylase large chain
Subtomogram averaging of Rubisco from native Halothiobacillus carboxysomes. Determined by electron microscopy at 3.3 Å resolution. Released 20 Jul 2022.
- Method
- Electron microscopy
- Resolution
- 3.3 Å
- Organism
- Halothiobacillus neapolitanus
- Chains
- 16
- Atoms
- 34,912
- Mol. weight
- 524.55 kDa
- Released
- 20 Jul 2022
Explore 7ZBT in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7ZBT contains 248 α-helices and 208 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, B, C, E, F and G: 26 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-17 | 4 | |
| β-strand | 18 | 1 | 1 |
| α-helix | 22-25 | 4 | |
| β-strand | 29-37 | 9 | 1 |
| α-helix | 38 | 1 | |
| α-helix | 43-55 | 13 | |
| α-helix | 61-62 | 2 | |
| α-helix | 65-67 | 3 | |
| β-strand | 76-83 | 8 | 1 |
| β-strand | 86-96 | 11 | 1 |
| α-helix | 98-100 | 3 | |
| α-helix | 106-114 | 9 | |
| α-helix | 117-119 | 3 | |
| β-strand | 123-132 | 10 | 1 |
| α-helix | 135-138 | 4 | |
| α-helix | 148-155 | 8 | |
| β-strand | 162-164 | 3 | 2 |
| β-strand | 166 | 1 | 3 |
| α-helix | 175-188 | 14 | |
| β-strand | 192-194 | 3 | 3 |
| β-strand | 202 | 1 | 4 |
| β-strand | 205 | 1 | 4 |
| α-helix | 207-225 | 19 | |
| β-strand | 230-232 | 3 | 3 |
| β-strand | 233-234 | 2 | 2 |
| α-helix | 240-253 | 14 | |
| β-strand | 257-261 | 5 | 2 |
| α-helix | 267-280 | 14 | |
| β-strand | 283-287 | 5 | 2 |
| α-helix | 291-295 | 5 | |
| β-strand | 301-302 | 2 | 1 |
| α-helix | 304-314 | 11 | |
| β-strand | 318-320 | 3 | 2 |
| α-helix | 329-331 | 3 | |
| α-helix | 333-343 | 11 | |
| β-strand | 346-347 | 2 | 5 |
| β-strand | 350 | 1 | 6 |
| β-strand | 355 | 1 | 6 |
| β-strand | 359-360 | 2 | 5 |
| α-helix | 364-366 | 3 | |
| β-strand | 368-371 | 4 | 2 |
| α-helix | 377-379 | 3 | |
| α-helix | 380-387 | 8 | |
| β-strand | 391-394 | 4 | 2 |
| α-helix | 397-400 | 4 | |
| α-helix | 406-425 | 20 | |
| α-helix | 434-442 | 9 | |
| α-helix | 446-455 | 10 | |
Chains D and H: 25 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-17 | 4 | |
| β-strand | 18 | 1 | 27 |
| α-helix | 22-25 | 4 | |
| β-strand | 29-37 | 9 | 27 |
| α-helix | 38 | 1 | |
| α-helix | 43-55 | 13 | |
| α-helix | 61-62 | 2 | |
| α-helix | 65-67 | 3 | |
| β-strand | 76-83 | 8 | 27 |
| β-strand | 86-96 | 11 | 27 |
| α-helix | 98-100 | 3 | |
| α-helix | 106-114 | 9 | |
| α-helix | 117-119 | 3 | |
| β-strand | 123-132 | 10 | 27 |
| α-helix | 135-138 | 4 | |
| α-helix | 148-155 | 8 | |
| β-strand | 162-164 | 3 | 28 |
| β-strand | 166 | 1 | 29 |
| α-helix | 175-188 | 14 | |
| β-strand | 192-194 | 3 | 29 |
| β-strand | 202 | 1 | 30 |
| β-strand | 205 | 1 | 30 |
| α-helix | 207-225 | 19 | |
| β-strand | 230-232 | 3 | 29 |
| β-strand | 233-234 | 2 | 28 |
| α-helix | 240-253 | 14 | |
| β-strand | 257-261 | 5 | 28 |
| α-helix | 267-280 | 14 | |
| β-strand | 283-287 | 5 | 28 |
| α-helix | 291-295 | 5 | |
| β-strand | 301-302 | 2 | 27 |
| α-helix | 304-314 | 11 | |
| β-strand | 318-320 | 3 | 28 |
| α-helix | 329-331 | 3 | |
| α-helix | 333-343 | 11 | |
| β-strand | 346-347 | 2 | 31 |
| β-strand | 350 | 1 | 32 |
| β-strand | 355 | 1 | 32 |
| β-strand | 359-360 | 2 | 31 |
| α-helix | 364-366 | 3 | |
| β-strand | 368-371 | 4 | 28 |
| α-helix | 380-387 | 8 | |
| β-strand | 391-394 | 4 | 28 |
| α-helix | 397-400 | 4 | |
| α-helix | 406-425 | 20 | |
| α-helix | 434-442 | 9 | |
| α-helix | 446-455 | 10 | |
Chain I: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 20-22 | 3 | |
| α-helix | 24-36 | 13 | |
| β-strand | 40-46 | 7 | 7 |
| α-helix | 48-50 | 3 | |
| α-helix | 56 | 1 | |
| β-strand | 57-59 | 3 | 7 |
| α-helix | 69-82 | 14 | |
| β-strand | 87-94 | 8 | 7 |
| β-strand | 99-107 | 9 | 7 |
Chain J: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 20-22 | 3 | |
| α-helix | 24-36 | 13 | |
| β-strand | 40-46 | 7 | 9 |
| α-helix | 48-50 | 3 | |
| α-helix | 56 | 1 | |
| β-strand | 57-58 | 2 | 9 |
| α-helix | 69-82 | 14 | |
| β-strand | 87-94 | 8 | 9 |
| β-strand | 99-107 | 9 | 9 |
Chain K: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 20-22 | 3 | |
| α-helix | 24-36 | 13 | |
| β-strand | 40-46 | 7 | 10 |
| α-helix | 56 | 1 | |
| β-strand | 57-59 | 3 | 10 |
| α-helix | 69-82 | 14 | |
| β-strand | 87-94 | 8 | 10 |
| β-strand | 99-107 | 9 | 10 |
Chains L and P: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 20-22 | 3 | |
| α-helix | 24-36 | 13 | |
| β-strand | 40-46 | 7 | 11 |
| α-helix | 56 | 1 | |
| β-strand | 57-58 | 2 | 11 |
| α-helix | 69-82 | 14 | |
| β-strand | 87-94 | 8 | 11 |
| β-strand | 99-107 | 9 | 11 |
Chain M: 7 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 20-22 | 3 | |
| α-helix | 24-36 | 13 | |
| α-helix | 39 | 1 | |
| β-strand | 40-46 | 7 | 8 |
| α-helix | 48-50 | 3 | |
| α-helix | 56 | 1 | |
| β-strand | 57-58 | 2 | 8 |
| α-helix | 69-82 | 14 | |
| β-strand | 87-94 | 8 | 8 |
| β-strand | 99-107 | 9 | 8 |
Chain N: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 20-22 | 3 | |
| α-helix | 24-36 | 13 | |
| β-strand | 40-46 | 7 | 12 |
| β-strand | 57-58 | 2 | 12 |
| α-helix | 69-82 | 14 | |
| β-strand | 87-94 | 8 | 12 |
| β-strand | 99-107 | 9 | 12 |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Ribulose bisphosphate carboxylase large chain | A, B, C, D, E, F, G, H | protein | 473 | Halothiobacillus neapolitanus | O85040 (AlphaFold model) |
| Ribulose bisphosphate carboxylase small subunit | I, J, K, L, M, N, O, P | protein | 110 | Halothiobacillus neapolitanus | P45686 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>7ZBT_1 Ribulose bisphosphate carboxylase large chain (chains A, B, C, D, E, F, G, H)
MAVKKYSAGVKEYRQTYWMPEYTPLDSDILACFKITPQPGVDREEAAAAVAAESSTGTWT
TVWTDLLTDMDYYKGRAYRIEDVPGDDAAFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAVRGLRLEDVRFPLAYVKTCGGPPHGIQVERDKMNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQDATETAEAQTGERKGHYLNVTAPTP
EEMYKRAEFAKEIGAPIIMHDYITGGFTANTGLAKWCQDNGVLLHIHRAMHAVIDRNPNH
GIHFRVLTKILRLSGGDHLHTGTVVGKLEGDRASTLGWIDLLRESFIPEDRSRGIFFDQD
WGSMPGVFAVASGGIHVWHMPALVNIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNQGRDIEKEGKEILTAAAQHSPELKIAMETWKEIKFEFDTVDKLDTQNR
Sequence of entity 2 (I, J, K, L, M, N, O, P), FASTA
>7ZBT_2 Ribulose bisphosphate carboxylase small subunit (chains I, J, K, L, M, N, O, P)
MAEMQDYKQSLKYETFSYLPPMNAERIRAQIKYAIAQGWSPGIEHVEVKNSMNQYWYMWK
LPFFGEQNVDNVLAEIEACRSAYPTHQVKLVAYDNYAQSLGLAFVVYRGN
Primary citation
Structure and assembly of cargo Rubisco in two native alpha-carboxysomes. Ni, T., Sun, Y., Burn, W. et al. Nat Commun (2022) 13:4299-4299. DOI 10.1038/s41467-022-32004-w · PubMed
Other PDB entries of the same protein (UniProt O85040 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1SVD 1.8 Å, The structure of Halothiobacillus neapolitanus RuBisCo
- 7SMK 1.98 Å, H. neapolitanus carboxysomal rubisco/CsoSCA-peptide (1-50)complex
- 7SNV 2.07 Å, H. neapolitanus carboxysomal rubisco/CsoSCA-peptide (1-50)complex
- 6UEW 2.4 Å, Rubisco / CsoS2 N-peptide complex responsible for alpha-carboxysome cargo loading
Browse structure collections
About this viewer
MolViewer shows 7ZBT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.