6UNA: Inactive p38gamma

Crystal structure of inactive p38gamma. Determined by X-ray diffraction at 2.55 Å resolution. Released 18 Dec 2019.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,422
Mol. weight: 83.24 kDa
Released: 18 Dec 2019

Explore 6UNA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UNA contains 45 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
β-strand	18-24	7	2
β-strand	27-34	8	3
β-strand	39-46	8	3
β-strand	52-58	7	3
α-helix	65-80	16
β-strand	86	1	4
β-strand	91-93	3	3
α-helix	99-101	3
β-strand	106-110	5	3
β-strand	114-115	2	4
α-helix	116-122	7
α-helix	127-146	20
α-helix	156-158	3
β-strand	159-161	3	4
β-strand	167-169	3	4
α-helix	194-197	4
α-helix	206-221	16
α-helix	231-242	12
α-helix	244-246	3
α-helix	247-251	5
α-helix	256-263	8
α-helix	266-267	2
α-helix	269-272	4
α-helix	273-276	4
α-helix	282-291	10
α-helix	296-298	3
α-helix	300-301	2
α-helix	302-306	5
α-helix	309-311	3
α-helix	315-316	2
α-helix	324-326	3
α-helix	329-332	4
α-helix	337-349	13

Chain B: 22 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	2
β-strand	20-24	5	1
β-strand	27-34	8	5
β-strand	39-46	8	5
β-strand	52-58	7	5
α-helix	65-80	16
β-strand	86	1	6
β-strand	91-93	3	5
α-helix	99-101	3
β-strand	106-110	5	5
β-strand	114-115	2	6
α-helix	116-122	7
α-helix	127-146	20
α-helix	156-158	3
β-strand	159-161	3	6
β-strand	167-169	3	6
α-helix	194-197	4
α-helix	206-221	16
α-helix	231-242	12
α-helix	244-246	3
α-helix	247-251	5
α-helix	256-263	8
α-helix	266-267	2
α-helix	269-272	4
α-helix	273-276	4
α-helix	282-291	10
α-helix	296-298	3
α-helix	302-306	5
α-helix	309-311	3
α-helix	315-316	2
α-helix	320-321	2
α-helix	324-326	3
α-helix	337-349	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase 12	A, B	protein	361	Homo sapiens	P53778 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6UNA_1 Mitogen-activated protein kinase 12 (chains A, B)
ARSGFYRQEVTKTAWEVRAVYRDLRPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSEL
FAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLG
EDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYV
VTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPP
AEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEAL
AHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETP
L

Primary citation

A Dynamic Switch in Inactive p38 gamma Leads to an Excited State on the Pathway to an Active Kinase. Aoto, P.C., Stanfield, R.L., Wilson, I.A. et al. Biochemistry (2019) 58:5160-5172. DOI 10.1021/acs.biochem.9b00932 · PubMed

Other PDB entries of the same protein (UniProt P53778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CM8 2.4 Å, Phosphorylated map kinase P38-gamma
4QUM 2.52 Å, Crystal structure of PTPN3 (PTPH1) in complex with a dually phosphorylated MAPK12 peptide
7CGA 3.15 Å, Crystal structure of human unphosphorylated p38gamma

Browse structure collections

About this viewer

MolViewer shows 6UNA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.