7CGA: Human unphosphorylated p38gamma

Crystal structure of human unphosphorylated p38gamma. Determined by X-ray diffraction at 3.15 Å resolution. Released 30 Jun 2021.

Method: X-ray diffraction
Resolution: 3.15 Å
Organism: Homo sapiens
Chains: 4
Atoms: 11,422
Mol. weight: 159.63 kDa
Released: 30 Jun 2021

Explore 7CGA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CGA contains 63 α-helices and 57 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	11-16	6	1
β-strand	19-24	6	1
β-strand	27-35	9	2
β-strand	39-46	8	2
β-strand	52-58	7	2
α-helix	65-80	16
β-strand	83	1	3
β-strand	86	1	3
β-strand	91-93	3	2
α-helix	99-101	3
β-strand	106-110	5	2
β-strand	114-115	2	3
α-helix	118-121	4
α-helix	129-146	18
β-strand	149-150	2	4
α-helix	156-158	3
β-strand	159-161	3	3
β-strand	167-169	3	3
β-strand	176-177	2	4
α-helix	194-197	4
α-helix	206-221	16
α-helix	231-242	12
α-helix	246-249	4
α-helix	256-263	8
α-helix	273-276	4
α-helix	282-291	10
α-helix	300-301	2
α-helix	302-306	5
α-helix	309-314	6
α-helix	324-326	3
α-helix	329-332	4
α-helix	337-349	13

Chain B: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	11-16	6	5
β-strand	19-24	6	5
β-strand	28-36	9	6
β-strand	39-45	7	6
β-strand	52-58	7	6
α-helix	65-79	15
β-strand	83	1	7
β-strand	86	1	7
β-strand	91-93	3	6
β-strand	106-110	5	6
β-strand	115	1	7
α-helix	116-122	7
α-helix	124-126	3
α-helix	127-146	20
β-strand	149-150	2	8
α-helix	156-158	3
β-strand	159-161	3	7
β-strand	167-169	3	7
β-strand	176-177	2	8
α-helix	194-197	4
α-helix	206-221	16
α-helix	231-242	12
α-helix	256-264	9
α-helix	273-276	4
α-helix	282-291	10
α-helix	302-306	5
α-helix	309-311	3
α-helix	324-326	3
α-helix	337-350	14

Chain C: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	9
β-strand	19	1	5
β-strand	20-24	5	9
β-strand	27-32	6	10
β-strand	39-46	8	10
β-strand	52-58	7	10
α-helix	65-80	16
β-strand	83	1	11
β-strand	86	1	11
β-strand	91-93	3	10
α-helix	99-101	3
β-strand	106-110	5	10
β-strand	114-115	2	11
α-helix	127-146	20
β-strand	149-150	2	12
α-helix	156-158	3
β-strand	159-161	3	11
β-strand	167-169	3	11
β-strand	176-177	2	12
α-helix	194-197	4
α-helix	206-221	16
α-helix	231-242	12
α-helix	247-251	5
α-helix	256-263	8
α-helix	273-276	4
α-helix	282-291	10
α-helix	302-307	6
α-helix	309-311	3
α-helix	324-326	3
α-helix	337-349	13

Chain D: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	11-16	6	13
β-strand	19-24	6	13
β-strand	27-36	10	14
β-strand	39-46	8	14
β-strand	52-58	7	14
α-helix	65-79	15
β-strand	83	1	15
β-strand	86	1	15
β-strand	91-93	3	14
β-strand	106-110	5	14
β-strand	114-115	2	15
α-helix	116-122	7
α-helix	127-146	20
β-strand	149-150	2	16
α-helix	156-158	3
β-strand	159-161	3	15
β-strand	167-169	3	15
β-strand	176-177	2	16
α-helix	194-198	5
α-helix	207-221	15
α-helix	231-242	12
α-helix	256-263	8
α-helix	273-276	4
α-helix	282-291	10
α-helix	300-301	2
α-helix	302-306	5
α-helix	309-311	3
α-helix	324-326	3
α-helix	337-349	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase 12	A, B, C, D	protein	348	Homo sapiens	P53778 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7CGA_1 Mitogen-activated protein kinase 12 (chains A, B, C, D)
SNASGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSE
LFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKL
GEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGY
VVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTP
PAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEA
LAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKP

Primary citation

Structural basis for allosteric regulation of protein tyrosine phosphatase PTPN3 by unphosphorylated MAP kinase p38g. Hsu, S.F., Chen, K.E., Lee, C.C. et al. To be published.

Other PDB entries of the same protein (UniProt P53778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CM8 2.4 Å, Phosphorylated map kinase P38-gamma
4QUM 2.52 Å, Crystal structure of PTPN3 (PTPH1) in complex with a dually phosphorylated MAPK12 peptide
6UNA 2.55 Å, Crystal structure of inactive p38gamma

Browse structure collections

About this viewer

MolViewer shows 7CGA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.