Barrier-to-autointegration factor soaked in 1,6-hexanediol: 1 of 14 in MSCS set. Determined by X-ray diffraction at 1.65 Å resolution. Released 7 Oct 2020.
Explore 6USI in 3D Show helices and sheets RCSB PDB PDBe
6USI contains 12 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-11 | 7 | |
| β-strand | 19 | 1 | 1 |
| α-helix | 20-22 | 3 | |
| α-helix | 28-36 | 9 | |
| β-strand | 41 | 1 | 1 |
| α-helix | 42-51 | 10 | |
| α-helix | 56-67 | 12 | |
| α-helix | 71-88 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Barrier-to-autointegration factor | A, B | protein | 89 | Homo sapiens | O75531 (AlphaFold model) |
>6USI_1 Barrier-to-autointegration factor (chains A, B) MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR EWLKDTCGANAKQSRDCFGCLREWCDAFL
| ID | Name | Formula | Copies |
|---|---|---|---|
| EOH | Ethanol | C2 H6 O | 2 |
Development of a structure-analysis pipeline using multiple-solvent crystal structures of barrier-to-autointegration factor. Agarwal, S., Smith, M., De La Rosa, I. et al. Acta Crystallogr D Struct Biol (2020) 76:1001-1014. DOI 10.1107/S2059798320011341 · PubMed
Other PDB entries of the same protein (UniProt O75531 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6USI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.