7Z21: BAF A12T

BAF A12T bound to the lamin A/C Ig-fold domain. Determined by X-ray diffraction at 1.63 Å resolution. Released 24 Aug 2022.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,414
Mol. weight: 74.43 kDa
Released: 24 Aug 2022

Explore 7Z21 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z21 contains 28 α-helices and 32 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	19	1	1
α-helix	20-22	3
α-helix	28-36	9
β-strand	41	1	1
α-helix	42-51	10
α-helix	56-67	12
α-helix	71-88	18

Chains E and F: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	430-436	7	5
β-strand	440-445	6	6
β-strand	451-456	6	6
β-strand	462-463	2	7
β-strand	468-473	6	5
α-helix	477-478	2
β-strand	479-482	4	5
β-strand	488-489	2	7
β-strand	494-499	6	6
α-helix	500-502	3
β-strand	507	1	6
β-strand	511-514	4	6
β-strand	525-531	7	5
β-strand	537-545	9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Barrier-to-autointegration factor, N-terminally processed	A, B, C, D	protein	89	Homo sapiens	O75531 (AlphaFold model)
Lamin-A/C	E, F	protein	156	Homo sapiens	P02545 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7Z21_1 Barrier-to-autointegration factor, N-terminally processed (chains A, B, C, D)
GTTSQKHRDFVTEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR
EWLKDTAGANAKQSRDAFGALREWADAFL

Sequence of entity 2 (E, F), FASTA

>7Z21_2 Lamin-A/C (chains E, F)
GGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIK
RQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTAL
INSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHH

Primary citation

The BAF A12T mutation disrupts lamin A/C interaction, impairing robust repair of nuclear envelope ruptures in Nestor-Guillermo progeria syndrome cells. Janssen, A., Marcelot, A., Breusegem, S. et al. Nucleic Acids Res (2022) 50:9260-9278. DOI 10.1093/nar/gkac726 · PubMed

Other PDB entries of the same protein (UniProt O75531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDY 1.44 Å, Di-phosphorylated Barrier-to-Autointegration Factor (BAF) in complex with LEM domain of…
6URE 1.65 Å, Barrier-to-autointegration factor Aqueous: 1 of 14 in MSCS set
6URJ 1.65 Å, Barrier-to-autointegration factor soaked in Acetone: 1 of 14 in MSCS set
6URZ 1.65 Å, Barrier-to-autointegration factor soaked in methanol: 1 of 14 in MSCS set
6US0 1.65 Å, Barrier-to-autointegration factor soaked in R,S,R-bisfuranol (RSR): 1 of 14 in MSCS set
6US1 1.65 Å, Barrier-to-autointegration factor soaked in isobutanol: 1 of 14 in MSCS set
6US7 1.65 Å, Barrier-to-autointegration factor soaked in TMAO: 1 of 14 in MSCS set
6USD 1.65 Å, Barrier-to-autointegration factor soaked in ethanol: 1 of 14 in MSCS set
6USI 1.65 Å, Barrier-to-autointegration factor soaked in 1,6-hexanediol: 1 of 14 in MSCS set
6URN 1.68 Å, Barrier-to-autointegration factor t-butanol: 1 of 14 in MSCS set
6USB 1.68 Å, Barrier-to-autointegration factor soaked in urea: 1 of 14 in MSCS set
6URL 1.72 Å, Barrier-to-autointegration factor soaked in isopropanol: 1 of 14 in MSCS set

Browse structure collections

About this viewer

MolViewer shows 7Z21 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.