6UT2: Leiomodin/tropomyosin binding interface

3D structure of the leiomodin/tropomyosin binding interface. Determined by solution NMR. Released 30 Sept 2020.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 870
Mol. weight: 12.49 kDa
Released: 30 Sept 2020

Explore 6UT2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UT2 contains 5 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-6	4
α-helix	18-21	4
α-helix	27-40	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1-28	28

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-28	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leiomodin-2	A	protein	40	Homo sapiens	Q6P5Q4 (AlphaFold model)
Tropomyosin alpha-1 chain chimeric peptide	B, C	protein	33	Homo sapiens	P03069 (AlphaFold model), P09493 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6UT2_1 Leiomodin-2 (chains A)
STFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIE

Sequence of entity 2 (B, C), FASTA

>6UT2_2 Tropomyosin alpha-1 chain chimeric peptide (chains B, C)
GMDAIKKKMQMLKLDNYHLENEVARLKKLVGER

Primary citation

Leiomodin creates a leaky cap at the pointed end of actin-thin filaments. Tolkatchev, D., Smith Jr., G.E., Schultz, L.E. et al. PLoS Biol (2020) 18:e3000848-e3000848. DOI 10.1371/journal.pbio.3000848 · PubMed

Other PDB entries of the same protein (UniProt Q6P5Q4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RWT 2.98 Å, Structure of actin-Lmod complex
5WFN 3.0 Å, Revised model of leiomodin 2-mediated actin regulation (alternate refinement of PDB 4RWT)
9ZZJ 3.28 Å, One Lmod2 at the pointed end of F-actin
9ZZM 3.56 Å, Two Lmod2s and incoming actin at the pointed end of F-actin
9ZZK 4.06 Å, One Lmod2 and incoming actin at the pointed end of F-actin

Browse structure collections

About this viewer

MolViewer shows 6UT2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.