6UUI: Keratin, type II cytoskeletal 1

Crystal structure of the heterocomplex between coil 2B domains of wild-type keratin 1 (KRT1) and keratin 10 (KRT10) containing mutation Cys401Ala. Determined by X-ray diffraction at 2.07 Å resolution. Released 13 Nov 2019.

Method: X-ray diffraction
Resolution: 2.07 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,886
Mol. weight: 28.34 kDa
Ligands: BOG
Released: 13 Nov 2019

Explore 6UUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UUI contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	384-488	105

Chain X: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	350-454	105

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Keratin, type II cytoskeletal 1	C	protein	120	Homo sapiens	P04264 (AlphaFold model)
Keratin, type I cytoskeletal 10	X	protein	122	Homo sapiens	P13645 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>6UUI_1 Keratin, type II cytoskeletal 1 (chains C)
ESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDA
EQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGE

Sequence of entity 2 (X), FASTA

>6UUI_2 Keratin, type I cytoskeletal 10 (chains X)
GSEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLA
ETEGRYAVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYRSLLE
GE

Ligands and cofactors

ID	Name	Formula	Copies
BOG	octyl beta-D-glucopyranoside	C14 H28 O6	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal Structure of Keratin 1/10(C401A) 2B Heterodimer Demonstrates a Proclivity for the C-Terminus of Helix 2B to Form Higher Order Molecular Contacts. Lomakin, I.B., Hinbest, A.J., Ho, M. et al. Yale J Biol Med (2020) 93:3-17. PubMed

Other PDB entries of the same protein (UniProt P04264 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6E2J 2.39 Å, Crystal structure of the heterocomplex between human keratin 1 coil 1B containing S233L…
4ZRY 3.3 Å, Crystal structure of the heterocomplex between coil 2B domains of human intermediate…

Browse structure collections

About this viewer

MolViewer shows 6UUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.