6UWZ: Torpedo acetylcholine receptor

Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin. Determined by electron microscopy at 2.69 Å resolution. Released 15 Apr 2020.

Method: Electron microscopy
Resolution: 2.69 Å
Organisms: Tetronarce californica, Bungarus multicinctus
Chains: 7
Atoms: 18,330
Mol. weight: 294.42 kDa
Ligands: POV, NAG, OCT
Released: 15 Apr 2020

Explore 6UWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UWZ contains 70 α-helices and 102 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-44	16	1
β-strand	49-61	13	1
α-helix	69-72	4
β-strand	77-78	2	1
β-strand	90-92	3	2
β-strand	95	1	1
β-strand	109-111	3	1
β-strand	115-118	4	1
β-strand	121-127	7	1
β-strand	139-148	10	2
β-strand	156-160	5	1
β-strand	166	1	1
α-helix	170	1
β-strand	171	1	1
α-helix	172	1
β-strand	176-188	13	2
β-strand	189-190	2	3
β-strand	198-209	12	2
α-helix	213-216	4
α-helix	220-231	12
α-helix	232-234	3
α-helix	242-263	22
α-helix	273-299	27
α-helix	310-315	6
α-helix	320-322	3
α-helix	371-424	54
α-helix	428-432	5

Chain B: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
β-strand	31-46	16	4
β-strand	51-63	13	4
β-strand	80-82	3	4
β-strand	92-94	3	5
β-strand	97	1	4
α-helix	109	1
β-strand	110-112	3	4
β-strand	117-120	4	4
β-strand	123-129	7	4
β-strand	141-150	10	5
β-strand	158-162	5	4
α-helix	163	1
β-strand	164-166	3	6
β-strand	171-173	3	6
β-strand	176	1	7
β-strand	178	1	4
β-strand	190-194	5	5
β-strand	196	1	7
β-strand	197-201	5	5
β-strand	213-223	11	5
α-helix	227-228	2
α-helix	229-233	5
α-helix	234-245	12
α-helix	246-248	3
α-helix	256-275	20
α-helix	287-313	27
α-helix	324-327	4
α-helix	328-333	6
α-helix	334-338	5
α-helix	417-477	61

Chain C: 14 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-42	14	8
β-strand	49-66	18	8
α-helix	69-71	3
β-strand	77-80	4	8
α-helix	82-84	3
β-strand	90-92	3	9
β-strand	95	1	8
β-strand	104	1	8
α-helix	106-107	2
β-strand	108-111	4	8
β-strand	113-118	6	8
β-strand	121-127	7	8
β-strand	139-140	2	10
β-strand	144-148	5	9
β-strand	156-160	5	8
β-strand	161-162	2	11
β-strand	169-170	2	11
β-strand	172	1	12
β-strand	174-175	2	8
β-strand	176	1	13
β-strand	179	1	13
β-strand	181	1	8
β-strand	186-190	5	10
β-strand	192	1	12
β-strand	193-198	6	9
β-strand	201-209	9	9
β-strand	212-215	4	10
α-helix	218-220	3
α-helix	221-225	5
α-helix	226-237	12
α-helix	243-245	3
α-helix	248-267	20
α-helix	279-305	27
β-strand	312	1	14
α-helix	316-319	4
α-helix	320-325	6
α-helix	326-330	5
α-helix	399-459	61

Chain D: 16 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-44	16	15
β-strand	49-61	13	15
α-helix	63-65	3
α-helix	69-71	3
β-strand	77-78	2	15
α-helix	82-84	3
β-strand	90-92	3	16
β-strand	95	1	15
β-strand	109-111	3	15
β-strand	115-118	4	15
β-strand	121-127	7	15
β-strand	139-148	10	16
β-strand	156-160	5	15
β-strand	166	1	15
α-helix	170-172	3
β-strand	176-188	13	16
β-strand	190	1	17
β-strand	198-209	12	16
α-helix	213-214	2
α-helix	215-219	5
α-helix	220-229	10
α-helix	232-234	3
α-helix	242-263	22
α-helix	273-299	27
α-helix	310-312	3
α-helix	313-317	5
α-helix	320-323	4
β-strand	329	1	14
α-helix	372-424	53
α-helix	428-432	5

Chain E: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	29-44	16	18
β-strand	49-66	18	18
α-helix	69-72	4
β-strand	77-81	5	18
α-helix	82-84	3
β-strand	90-92	3	19
β-strand	95	1	18
β-strand	107-111	5	18
β-strand	113-118	6	18
β-strand	121-127	7	18
α-helix	132-134	3
β-strand	139-148	10	19
β-strand	156-160	5	18
β-strand	162-163	2	20
β-strand	166-167	2	20
β-strand	170	1	21
β-strand	172	1	18
β-strand	184-188	5	19
β-strand	190	1	21
β-strand	191-195	5	19
β-strand	207-217	11	19
α-helix	223-227	5
α-helix	228-234	7
α-helix	235-242	8
α-helix	251-270	20
α-helix	282-308	27
α-helix	316-318	3
α-helix	319-325	7
α-helix	411-472	62

Chain F: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	22
β-strand	12-15	4	22
β-strand	22-27	6	23
β-strand	39-40	2	3
β-strand	41-45	5	23
α-helix	48-50	3
β-strand	56-60	5	23

Chain G: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	24
β-strand	12-15	4	24
β-strand	24-26	3	25
β-strand	39	1	17
β-strand	41-43	3	25
α-helix	48-50	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine receptor subunit alpha	A, D	protein	437	Tetronarce californica	P02710 (AlphaFold model)
Acetylcholine receptor subunit delta	B	protein	501	Tetronarce californica	P02718 (AlphaFold model)
Acetylcholine receptor subunit beta	C	protein	469	Tetronarce californica	P02712 (AlphaFold model)
Acetylcholine receptor subunit gamma	E	protein	489	Tetronarce californica	P02714 (AlphaFold model)
Alpha-bungarotoxin	F, G	protein	74	Bungarus multicinctus	P60615

Sequence of entity 1 (A, D), FASTA

>6UWZ_1 Acetylcholine receptor subunit alpha (chains A, D)
SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQW
IDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTP
PAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKD
YRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIITVVVINTHH
RSPSTHTMPQWVRKIFIDTIPNVMFFSTMKRASKEKQENKIFADDIDISDISGKQVTGEV
IFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICII
GTVSVFAGRLIELSQEG

Sequence of entity 2 (B), FASTA

>6UWZ_2 Acetylcholine receptor subunit delta (chains B)
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTSNVWMDH
AWYDHRLTWNASEYSDISILRLPPELVWIPDIVLQNNNDGQYHVAYFCNVLVRPNGYVTW
LPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYDANEITMDLMTDTIDGKDYPIEWIIID
PEAFTENGEWEIIHKPAKKNIYPDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLIS
FLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVT
GVIVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILHMSRADESEQPDWQNDLKLRRS
SSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPRIGFGNNNENIAASDQLHDEIK
SGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNH
PPAKPFEGDPFDYSSDHPRCA

Sequence of entity 3 (C), FASTA

>6UWZ_3 Acetylcholine receptor subunit beta (chains C)
SVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRVGLTLTNLLILNEKIEEMTTNVFLNLAW
TDYRLQWDPAAYEGIKDLRIPSSDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWQP
SAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVTLQHALDAKGEREVKEIVINKDAF
TENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIIPCILISILAILVFY
LPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVV
VLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPVTTPSPDSKPTIISRANDEYFIRKP
AGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVEAIKYIAEQLESASE
FDDLKKDWQYVAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDNPFA

Sequence of entity 4 (E), FASTA

>6UWZ_4 Acetylcholine receptor subunit gamma (chains E)
ENEEGRLIEKLLGDYDKRIIPAKTLDHIIDVTLKLTLTNLISLNEKEEALTTNVWIEIQW
NDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLP
PAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEAVEWIHIDPEDFTE
NGEWTIRHRPAKKNYNWQLTKDDTDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLV
YFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMN
CVIVLNVSLRTPNTHSLSEKIKHLFLGFLPKYLGMQLEPSEETPEKPQPRRRSSFGIMIK
AEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYKDLANFAPEIKSCVEAC
NFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEFPF
PGDPRKYVP

Sequence of entity 5 (F, G), FASTA

>6UWZ_5 Alpha-bungarotoxin (chains F, G)
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	5
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
OCT	N-octane	C8 H18	1

Primary citation

Structure of the Native Muscle-type Nicotinic Receptor and Inhibition by Snake Venom Toxins. Rahman, M.M., Teng, J., Worrell, B.T. et al. Neuron (2020) 106:952-962.e5. DOI 10.1016/j.neuron.2020.03.012 · PubMed

Other PDB entries of the same protein (UniProt P02710 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8YQN 2.27 Å, Torpedo acetylcholine receptor in complex with Erabutoxin A
7QL5 2.5 Å, Torpedo muscle-type nicotinic acetylcholine receptor - nicotine-bound conformation
7SMM 2.5 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form
7SMT 2.56 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with d-tubocurarine and…
8F6Z 2.7 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
7SMQ 2.74 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form with added cholesterol
7SMR 2.77 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with carbachol,…
8F6Y 2.79 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with etomidate,…
9E3E 2.8 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Diliganded State
7QKO 2.9 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Resting conformation
8ESK 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
8F2S 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…

Browse structure collections

About this viewer

MolViewer shows 6UWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.