6UWZ: Torpedo acetylcholine receptor
Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin. Determined by electron microscopy at 2.69 Å resolution. Released 15 Apr 2020.
- Method
- Electron microscopy
- Resolution
- 2.69 Å
- Organisms
- Tetronarce californica, Bungarus multicinctus
- Chains
- 7
- Atoms
- 18,330
- Mol. weight
- 294.42 kDa
- Ligands
- POV, NAG, OCT
- Released
- 15 Apr 2020
Explore 6UWZ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6UWZ contains 70 α-helices and 102 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 1 |
| β-strand | 49-61 | 13 | 1 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-78 | 2 | 1 |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 95 | 1 | 1 |
| β-strand | 109-111 | 3 | 1 |
| β-strand | 115-118 | 4 | 1 |
| β-strand | 121-127 | 7 | 1 |
| β-strand | 139-148 | 10 | 2 |
| β-strand | 156-160 | 5 | 1 |
| β-strand | 166 | 1 | 1 |
| α-helix | 170 | 1 | |
| β-strand | 171 | 1 | 1 |
| α-helix | 172 | 1 | |
| β-strand | 176-188 | 13 | 2 |
| β-strand | 189-190 | 2 | 3 |
| β-strand | 198-209 | 12 | 2 |
| α-helix | 213-216 | 4 | |
| α-helix | 220-231 | 12 | |
| α-helix | 232-234 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-315 | 6 | |
| α-helix | 320-322 | 3 | |
| α-helix | 371-424 | 54 | |
| α-helix | 428-432 | 5 | |
Chain B: 13 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| β-strand | 31-46 | 16 | 4 |
| β-strand | 51-63 | 13 | 4 |
| β-strand | 80-82 | 3 | 4 |
| β-strand | 92-94 | 3 | 5 |
| β-strand | 97 | 1 | 4 |
| α-helix | 109 | 1 | |
| β-strand | 110-112 | 3 | 4 |
| β-strand | 117-120 | 4 | 4 |
| β-strand | 123-129 | 7 | 4 |
| β-strand | 141-150 | 10 | 5 |
| β-strand | 158-162 | 5 | 4 |
| α-helix | 163 | 1 | |
| β-strand | 164-166 | 3 | 6 |
| β-strand | 171-173 | 3 | 6 |
| β-strand | 176 | 1 | 7 |
| β-strand | 178 | 1 | 4 |
| β-strand | 190-194 | 5 | 5 |
| β-strand | 196 | 1 | 7 |
| β-strand | 197-201 | 5 | 5 |
| β-strand | 213-223 | 11 | 5 |
| α-helix | 227-228 | 2 | |
| α-helix | 229-233 | 5 | |
| α-helix | 234-245 | 12 | |
| α-helix | 246-248 | 3 | |
| α-helix | 256-275 | 20 | |
| α-helix | 287-313 | 27 | |
| α-helix | 324-327 | 4 | |
| α-helix | 328-333 | 6 | |
| α-helix | 334-338 | 5 | |
| α-helix | 417-477 | 61 | |
Chain C: 14 helices, 25 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-42 | 14 | 8 |
| β-strand | 49-66 | 18 | 8 |
| α-helix | 69-71 | 3 | |
| β-strand | 77-80 | 4 | 8 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 9 |
| β-strand | 95 | 1 | 8 |
| β-strand | 104 | 1 | 8 |
| α-helix | 106-107 | 2 | |
| β-strand | 108-111 | 4 | 8 |
| β-strand | 113-118 | 6 | 8 |
| β-strand | 121-127 | 7 | 8 |
| β-strand | 139-140 | 2 | 10 |
| β-strand | 144-148 | 5 | 9 |
| β-strand | 156-160 | 5 | 8 |
| β-strand | 161-162 | 2 | 11 |
| β-strand | 169-170 | 2 | 11 |
| β-strand | 172 | 1 | 12 |
| β-strand | 174-175 | 2 | 8 |
| β-strand | 176 | 1 | 13 |
| β-strand | 179 | 1 | 13 |
| β-strand | 181 | 1 | 8 |
| β-strand | 186-190 | 5 | 10 |
| β-strand | 192 | 1 | 12 |
| β-strand | 193-198 | 6 | 9 |
| β-strand | 201-209 | 9 | 9 |
| β-strand | 212-215 | 4 | 10 |
| α-helix | 218-220 | 3 | |
| α-helix | 221-225 | 5 | |
| α-helix | 226-237 | 12 | |
| α-helix | 243-245 | 3 | |
| α-helix | 248-267 | 20 | |
| α-helix | 279-305 | 27 | |
| β-strand | 312 | 1 | 14 |
| α-helix | 316-319 | 4 | |
| α-helix | 320-325 | 6 | |
| α-helix | 326-330 | 5 | |
| α-helix | 399-459 | 61 | |
Chain D: 16 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 15 |
| β-strand | 49-61 | 13 | 15 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-71 | 3 | |
| β-strand | 77-78 | 2 | 15 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 16 |
| β-strand | 95 | 1 | 15 |
| β-strand | 109-111 | 3 | 15 |
| β-strand | 115-118 | 4 | 15 |
| β-strand | 121-127 | 7 | 15 |
| β-strand | 139-148 | 10 | 16 |
| β-strand | 156-160 | 5 | 15 |
| β-strand | 166 | 1 | 15 |
| α-helix | 170-172 | 3 | |
| β-strand | 176-188 | 13 | 16 |
| β-strand | 190 | 1 | 17 |
| β-strand | 198-209 | 12 | 16 |
| α-helix | 213-214 | 2 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-229 | 10 | |
| α-helix | 232-234 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-312 | 3 | |
| α-helix | 313-317 | 5 | |
| α-helix | 320-323 | 4 | |
| β-strand | 329 | 1 | 14 |
| α-helix | 372-424 | 53 | |
| α-helix | 428-432 | 5 | |
Chain E: 12 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-11 | 9 | |
| β-strand | 29-44 | 16 | 18 |
| β-strand | 49-66 | 18 | 18 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 18 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 19 |
| β-strand | 95 | 1 | 18 |
| β-strand | 107-111 | 5 | 18 |
| β-strand | 113-118 | 6 | 18 |
| β-strand | 121-127 | 7 | 18 |
| α-helix | 132-134 | 3 | |
| β-strand | 139-148 | 10 | 19 |
| β-strand | 156-160 | 5 | 18 |
| β-strand | 162-163 | 2 | 20 |
| β-strand | 166-167 | 2 | 20 |
| β-strand | 170 | 1 | 21 |
| β-strand | 172 | 1 | 18 |
| β-strand | 184-188 | 5 | 19 |
| β-strand | 190 | 1 | 21 |
| β-strand | 191-195 | 5 | 19 |
| β-strand | 207-217 | 11 | 19 |
| α-helix | 223-227 | 5 | |
| α-helix | 228-234 | 7 | |
| α-helix | 235-242 | 8 | |
| α-helix | 251-270 | 20 | |
| α-helix | 282-308 | 27 | |
| α-helix | 316-318 | 3 | |
| α-helix | 319-325 | 7 | |
| α-helix | 411-472 | 62 | |
Chain F: 1 helix, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-5 | 4 | 22 |
| β-strand | 12-15 | 4 | 22 |
| β-strand | 22-27 | 6 | 23 |
| β-strand | 39-40 | 2 | 3 |
| β-strand | 41-45 | 5 | 23 |
| α-helix | 48-50 | 3 | |
| β-strand | 56-60 | 5 | 23 |
Chain G: 1 helix, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-5 | 4 | 24 |
| β-strand | 12-15 | 4 | 24 |
| β-strand | 24-26 | 3 | 25 |
| β-strand | 39 | 1 | 17 |
| β-strand | 41-43 | 3 | 25 |
| α-helix | 48-50 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acetylcholine receptor subunit alpha | A, D | protein | 437 | Tetronarce californica | P02710 (AlphaFold model) |
| Acetylcholine receptor subunit delta | B | protein | 501 | Tetronarce californica | P02718 (AlphaFold model) |
| Acetylcholine receptor subunit beta | C | protein | 469 | Tetronarce californica | P02712 (AlphaFold model) |
| Acetylcholine receptor subunit gamma | E | protein | 489 | Tetronarce californica | P02714 (AlphaFold model) |
| Alpha-bungarotoxin | F, G | protein | 74 | Bungarus multicinctus | P60615 |
Sequence of entity 1 (A, D), FASTA
>6UWZ_1 Acetylcholine receptor subunit alpha (chains A, D)
SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQW
IDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTP
PAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKD
YRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIITVVVINTHH
RSPSTHTMPQWVRKIFIDTIPNVMFFSTMKRASKEKQENKIFADDIDISDISGKQVTGEV
IFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICII
GTVSVFAGRLIELSQEG
Sequence of entity 2 (B), FASTA
>6UWZ_2 Acetylcholine receptor subunit delta (chains B)
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTSNVWMDH
AWYDHRLTWNASEYSDISILRLPPELVWIPDIVLQNNNDGQYHVAYFCNVLVRPNGYVTW
LPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYDANEITMDLMTDTIDGKDYPIEWIIID
PEAFTENGEWEIIHKPAKKNIYPDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLIS
FLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVT
GVIVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILHMSRADESEQPDWQNDLKLRRS
SSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPRIGFGNNNENIAASDQLHDEIK
SGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNH
PPAKPFEGDPFDYSSDHPRCA
Sequence of entity 3 (C), FASTA
>6UWZ_3 Acetylcholine receptor subunit beta (chains C)
SVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRVGLTLTNLLILNEKIEEMTTNVFLNLAW
TDYRLQWDPAAYEGIKDLRIPSSDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWQP
SAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVTLQHALDAKGEREVKEIVINKDAF
TENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIIPCILISILAILVFY
LPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVV
VLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPVTTPSPDSKPTIISRANDEYFIRKP
AGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVEAIKYIAEQLESASE
FDDLKKDWQYVAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDNPFA
Sequence of entity 4 (E), FASTA
>6UWZ_4 Acetylcholine receptor subunit gamma (chains E)
ENEEGRLIEKLLGDYDKRIIPAKTLDHIIDVTLKLTLTNLISLNEKEEALTTNVWIEIQW
NDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLP
PAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEAVEWIHIDPEDFTE
NGEWTIRHRPAKKNYNWQLTKDDTDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLV
YFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMN
CVIVLNVSLRTPNTHSLSEKIKHLFLGFLPKYLGMQLEPSEETPEKPQPRRRSSFGIMIK
AEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYKDLANFAPEIKSCVEAC
NFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEFPF
PGDPRKYVP
Sequence of entity 5 (F, G), FASTA
>6UWZ_5 Alpha-bungarotoxin (chains F, G)
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| POV | (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl… | C42 H82 N O8 P | 5 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
| OCT | N-octane | C8 H18 | 1 |
Primary citation
Structure of the Native Muscle-type Nicotinic Receptor and Inhibition by Snake Venom Toxins. Rahman, M.M., Teng, J., Worrell, B.T. et al. Neuron (2020) 106:952-962.e5. DOI 10.1016/j.neuron.2020.03.012 · PubMed
Other PDB entries of the same protein (UniProt P02710 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8YQN 2.27 Å, Torpedo acetylcholine receptor in complex with Erabutoxin A
- 7QL5 2.5 Å, Torpedo muscle-type nicotinic acetylcholine receptor - nicotine-bound conformation
- 7SMM 2.5 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form
- 7SMT 2.56 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with d-tubocurarine and…
- 8F6Z 2.7 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
- 7SMQ 2.74 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form with added cholesterol
- 7SMR 2.77 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with carbachol,…
- 8F6Y 2.79 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with etomidate,…
- 9E3E 2.8 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Diliganded State
- 7QKO 2.9 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Resting conformation
- 8ESK 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
- 8F2S 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
Browse structure collections
About this viewer
MolViewer shows 6UWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.