8YQN: Torpedo acetylcholine receptor

Torpedo acetylcholine receptor in complex with Erabutoxin A. Determined by electron microscopy at 2.27 Å resolution. Released 28 May 2025.

Method: Electron microscopy
Resolution: 2.27 Å
Organisms: Tetronarce californica, Laticauda semifasciata
Chains: 7
Atoms: 18,056
Mol. weight: 291.06 kDa
Ligands: POV, PLM, OCT, NAG
Released: 28 May 2025

Explore 8YQN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YQN contains 81 α-helices and 97 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	29-44	16	1
β-strand	49-61	13	1
α-helix	69-72	4
β-strand	77-80	4	1
α-helix	82-84	3
β-strand	90-92	3	2
β-strand	95	1	1
β-strand	108-111	4	1
β-strand	115-118	4	1
β-strand	121-127	7	1
β-strand	139-148	10	2
β-strand	156-160	5	1
β-strand	166	1	1
α-helix	170-172	3
β-strand	176-188	13	2
β-strand	198-209	12	2
α-helix	213-214	2
α-helix	215-219	5
α-helix	220-231	12
α-helix	232-234	3
α-helix	242-263	22
α-helix	273-299	27
α-helix	307-309	3
α-helix	310-318	9
α-helix	320-323	4
β-strand	329	1	3
α-helix	375-433	59

Chain B: 16 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	4-9	6
α-helix	10-14	5
β-strand	31-46	16	4
β-strand	51-63	13	4
α-helix	71-73	3
β-strand	80-82	3	4
β-strand	93-94	2	5
β-strand	97	1	4
α-helix	108-109	2
β-strand	110-112	3	4
β-strand	117-120	4	4
β-strand	123-129	7	4
β-strand	141-149	9	5
β-strand	158-162	5	4
β-strand	164-166	3	6
β-strand	171-173	3	6
β-strand	176	1	7
β-strand	178	1	4
α-helix	184-187	4
β-strand	190-194	5	5
β-strand	196	1	7
β-strand	197-201	5	5
β-strand	213-223	11	5
α-helix	227-228	2
α-helix	229-233	5
α-helix	234-240	7
α-helix	242-245	4
α-helix	251-253	3
α-helix	256-274	19
α-helix	287-313	27
α-helix	324-328	5
α-helix	329-333	5
α-helix	334-337	4
α-helix	417-477	61

Chain C: 19 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-42	14	8
β-strand	49-61	13	8
α-helix	69-72	4
β-strand	77-80	4	8
α-helix	82-84	3
β-strand	90-92	3	9
β-strand	95	1	8
β-strand	104	1	8
α-helix	106-107	2
β-strand	108-111	4	8
β-strand	115-118	4	8
β-strand	121-127	7	8
β-strand	139-148	10	9
β-strand	156-160	5	8
α-helix	161	1
β-strand	162	1	10
α-helix	163	1
β-strand	169	1	10
β-strand	172	1	11
β-strand	174	1	8
α-helix	177-179	3
β-strand	181	1	8
β-strand	186-190	5	9
β-strand	192	1	11
β-strand	193-198	6	9
β-strand	201-215	15	9
α-helix	218-220	3
α-helix	221-225	5
α-helix	226-237	12
α-helix	238-240	3
α-helix	243-245	3
α-helix	248-266	19
α-helix	279-305	27
β-strand	312	1	12
α-helix	316-320	5
α-helix	321-325	5
α-helix	326-330	5
α-helix	333-335	3
α-helix	399-459	61

Chain D: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-44	16	13
β-strand	49-61	13	13
α-helix	69-72	4
β-strand	77-80	4	13
α-helix	82-84	3
β-strand	90-92	3	14
β-strand	95	1	13
β-strand	108-111	4	13
β-strand	115-118	4	13
β-strand	121-127	7	13
β-strand	139-148	10	14
β-strand	156-160	5	13
β-strand	166	1	13
α-helix	170-172	3
β-strand	176-188	13	14
β-strand	198-209	12	14
α-helix	213-214	2
α-helix	215-219	5
α-helix	220-231	12
α-helix	232-234	3
α-helix	242-263	22
α-helix	273-299	27
α-helix	310-314	5
α-helix	315-319	5
α-helix	320-323	4
β-strand	329	1	12
α-helix	370-432	63

Chain E: 14 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
β-strand	29-44	16	15
β-strand	49-66	18	15
α-helix	69-72	4
β-strand	77-81	5	15
α-helix	82-84	3
β-strand	90-92	3	16
β-strand	95	1	15
β-strand	107-111	5	15
β-strand	113-118	6	15
β-strand	121-127	7	15
α-helix	129-131	3
β-strand	139-148	10	16
β-strand	156-160	5	15
β-strand	162-163	2	17
β-strand	166-167	2	17
β-strand	170	1	18
β-strand	172	1	15
α-helix	178-180	3
β-strand	184-188	5	16
β-strand	190	1	18
β-strand	191-195	5	16
β-strand	207-217	11	16
α-helix	221-222	2
α-helix	223-227	5
α-helix	228-234	7
α-helix	235-242	8
α-helix	251-270	20
α-helix	282-308	27
β-strand	315	1	3
α-helix	319-325	7
α-helix	329-332	4
α-helix	416-472	57

Chain F: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	19
α-helix	11-12	2
β-strand	14-16	3	19
α-helix	17-18	2
β-strand	24-30	7	20
β-strand	35-41	7	20
β-strand	51-54	4	20

Chain G: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	21
β-strand	7	1	22
α-helix	11-12	2
β-strand	14-16	3	21
α-helix	17-18	2
β-strand	25-30	6	22
β-strand	35-40	6	22
β-strand	51-54	4	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine receptor subunit alpha	A, D	protein	437	Tetronarce californica	P02710 (AlphaFold model)
Acetylcholine receptor subunit delta	B	protein	501	Tetronarce californica	P02718 (AlphaFold model)
Acetylcholine receptor subunit beta	C	protein	469	Tetronarce californica	P02712 (AlphaFold model)
Acetylcholine receptor subunit gamma	E	protein	489	Tetronarce californica	P02714 (AlphaFold model)
Erabutoxin a	F, G	protein	62	Laticauda semifasciata	P60775

Sequence of entity 1 (A, D), FASTA

>8YQN_1 Acetylcholine receptor subunit alpha (chains A, D)
SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQW
IDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTP
PAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKD
YRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIITVVVINTHH
RSPSTHTMPQWVRKIFIDTIPNVMFFSTMKRASKEKQENKIFADDIDISDISGKQVTGEV
IFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICII
GTVSVFAGRLIELSQEG

Sequence of entity 2 (B), FASTA

>8YQN_2 Acetylcholine receptor subunit delta (chains B)
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTSNVWMDH
AWYDHRLTWNASEYSDISILRLPPELVWIPDIVLQNNNDGQYHVAYFCNVLVRPNGYVTW
LPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYDANEITMDLMTDTIDGKDYPIEWIIID
PEAFTENGEWEIIHKPAKKNIYPDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLIS
FLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVT
GVIVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILHMSRADESEQPDWQNDLKLRRS
SSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPRIGFGNNNENIAASDQLHDEIK
SGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNH
PPAKPFEGDPFDYSSDHPRCA

Sequence of entity 3 (C), FASTA

>8YQN_3 Acetylcholine receptor subunit beta (chains C)
SVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRVGLTLTNLLILNEKIEEMTTNVFLNLAW
TDYRLQWDPAAYEGIKDLRIPSSDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWQP
SAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVTLQHALDAKGEREVKEIVINKDAF
TENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIIPCILISILAILVFY
LPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVV
VLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPVTTPSPDSKPTIISRANDEYFIRKP
AGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVEAIKYIAEQLESASE
FDDLKKDWQYVAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDNPFA

Sequence of entity 4 (E), FASTA

>8YQN_4 Acetylcholine receptor subunit gamma (chains E)
ENEEGRLIEKLLGDYDKRIIPAKTLDHIIDVTLKLTLTNLISLNEKEEALTTNVWIEIQW
NDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLP
PAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEAVEWIHIDPEDFTE
NGEWTIRHRPAKKNYNWQLTKDDTDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLV
YFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMN
CVIVLNVSLRTPNTHSLSEKIKHLFLGFLPKYLGMQLEPSEETPEKPQPRRRSSFGIMIK
AEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYKDLANFAPEIKSCVEAC
NFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEFPF
PGDPRKYVP

Sequence of entity 5 (F, G), FASTA

>8YQN_5 Erabutoxin a (chains F, G)
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVC
NN

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	4
PLM	Palmitic acid	C16 H32 O2	1
OCT	N-octane	C8 H18	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Structure of Erabutoxin bound to Torpedo acetylcholine receptor gives insight to intramolecular selectivity. Chan, C.Y.L., Li, H.H., Hibbs, R.E. et al. To be published.

Other PDB entries of the same protein (UniProt P02710 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QL5 2.5 Å, Torpedo muscle-type nicotinic acetylcholine receptor - nicotine-bound conformation
7SMM 2.5 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form
7SMT 2.56 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with d-tubocurarine and…
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
8F6Z 2.7 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
7SMQ 2.74 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form with added cholesterol
7SMR 2.77 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with carbachol,…
8F6Y 2.79 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with etomidate,…
9E3E 2.8 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Diliganded State
7QKO 2.9 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Resting conformation
8ESK 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
8F2S 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…

Browse structure collections

About this viewer

MolViewer shows 8YQN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.