7SI5: Eed with mrtx-1919

Crystal structure of eed with mrtx-1919. Determined by X-ray diffraction at 1.75 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,400
Mol. weight: 47.33 kDa
Ligands: 9L0
Released: 9 Nov 2022

Explore 7SI5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SI5 contains 9 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	82-89	8	1
α-helix	95	1
β-strand	96-101	6	2
α-helix	105-106	2
α-helix	110	1
β-strand	111-117	7	2
β-strand	120-126	7	2
β-strand	132-139	8	2
β-strand	147-154	8	3
β-strand	161-167	7	3
β-strand	171-176	6	3
β-strand	181-187	7	3
β-strand	193-198	6	4
β-strand	205-210	6	4
β-strand	215-219	5	4
β-strand	224-229	6	4
β-strand	239-244	6	5
β-strand	250-255	6	5
β-strand	260-264	5	5
α-helix	268-278	11
α-helix	282-284	3
α-helix	288-291	4
β-strand	292-294	3	4
β-strand	299-301	3	5
β-strand	311-315	5	6
β-strand	318-322	5	6
β-strand	327-333	7	6
α-helix	340-342	3
β-strand	350-357	8	6
β-strand	368-370	3	7
β-strand	376-380	5	7
β-strand	386-390	5	7
α-helix	396-398	3
α-helix	399	1
β-strand	400-404	5	7
β-strand	413-418	6	1
β-strand	424-429	6	1
β-strand	433-439	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polycomb protein EED	A	protein	402	Homo sapiens	O75530 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7SI5_1 Polycomb protein EED (chains A)
DAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGV
QFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTS
HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWN
IQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYD
YNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDD
IDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKA
KCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR

Ligands and cofactors

ID	Name	Formula	Copies
9L0	(4R)-8-(1,3-dimethyl-1H-pyrazol-5-yl)-5-{[(5-fluoro-2,3-dihydro-1-benzofuran-4-…	C21 H18 F N7 O	1

Water and common crystallization additives (NA, EDO, FMT) are not listed.

Primary citation

CRYSTAL STRUCTURE OF EED WITH MRTX-1919. Burns, A.C. To be published.

Other PDB entries of the same protein (UniProt O75530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5U69 1.28 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(2-methoxyphenyl)methyl]-N,N-d…
5U8F 1.34 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(1S)-7-fluoro-2,3-dihydro-1H-i…
5U8A 1.45 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(2-bromo-6-fluorophenyl)methyl…
6SFB 1.52 Å, EED in complex with a triazolopyrimidine
3K26 1.58 Å, Complex structure of EED and trimethylated H3K4
5U5T 1.6 Å, Crystal structure of EED in complex with H3K27Me3 peptide and…
7QK4 1.6 Å, EED in complex with PRC2 allosteric inhibitor compound 22 (MAK683)
7P3C 1.61 Å, EED in complex with compound 4
6V3Y 1.63 Å, Crystal structure of EED in complex with PALI1-K1219me3 peptide
5U6D 1.64 Å, Polycomb protein EED in complex with inhibitor: 2-[4-(4-{(3S,4R)-4-(dimethylamino)-1-[(2-…
6V3X 1.7 Å, Crystal structure of EED in complex with PALI1-K1241me3 peptide
5TTW 1.74 Å, Crystal Structure of EED in Complex with UNC4859

Browse structure collections

About this viewer

MolViewer shows 7SI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.