6V5A: Human BK channel gating ring L390P mutant

Crystal structure of the human BK channel gating ring L390P mutant. Determined by X-ray diffraction at 2.0 Å resolution. Released 1 Jul 2020.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,915
Mol. weight: 81.76 kDa
Ligands: CA
Released: 1 Jul 2020

Explore 6V5A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V5A contains 46 α-helices and 34 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 46 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	344-349	6	1
α-helix	353-366	14
α-helix	370-372	3
β-strand	374-379	6	1
α-helix	382-384	3
α-helix	388-394	7
β-strand	398-402	5	1
α-helix	408-413	6
α-helix	416-418	3
β-strand	421-425	5	1
α-helix	433-450	18
β-strand	456-460	5	1
α-helix	463-466	4
α-helix	467-471	5
α-helix	477-479	3
β-strand	482-485	4	1
α-helix	486-499	14
α-helix	503-509	7
α-helix	524-532	9
β-strand	535-540	6	2
α-helix	541-542	2
α-helix	543-545	3
β-strand	549	1	3
α-helix	550-556	7
α-helix	557-561	5
β-strand	564-569	6	2
β-strand	579-581	3	2
β-strand	588	1	3
α-helix	589-590	2
α-helix	593	1
β-strand	594-599	6	2
α-helix	602-605	4
α-helix	607-610	4
β-strand	686-687	2	4
β-strand	692	1	5
β-strand	693	1	4
α-helix	696-699	4
α-helix	700-702	3
β-strand	704	1	6
α-helix	707-712	6
β-strand	719-724	6	6
β-strand	730	1	7
α-helix	731	1
α-helix	735-738	4
α-helix	740-742	3
β-strand	743	1	5
α-helix	748-750	3
α-helix	751-753	3
β-strand	754-758	5	6
α-helix	760-766	7
α-helix	767-769	3
β-strand	776-780	5	6
α-helix	786-791	6
α-helix	794-796	3
β-strand	799-804	6	6
β-strand	806	1	7
α-helix	818-829	12
β-strand	831-832	2	8
β-strand	871-872	2	8
β-strand	878-882	5	6
α-helix	885-890	6
α-helix	903-905	3
α-helix	907-910	4
β-strand	914-916	3	6
α-helix	917-920	4
α-helix	922-929	8
α-helix	932-942	11
α-helix	951-956	6
β-strand	961-962	2	4
α-helix	966-970	5
β-strand	976-981	6	9
α-helix	988-991	4
β-strand	995	1	10
α-helix	996-1007	12
β-strand	1010-1017	8	9
β-strand	1031-1035	5	9
α-helix	1041	1
β-strand	1042	1	10
α-helix	1043	1
β-strand	1048-1053	6	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-activated potassium channel subunit alpha-1	A	protein	726	Homo sapiens	Q12791 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6V5A_1 Calcium-activated potassium channel subunit alpha-1 (chains A)
MGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEAPFKRHFTQVE
FYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQ
MLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKI
EEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRI
LINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPS
TLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKE
IEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGS
IEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKE
CILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPII
TELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRT
LVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDL
FCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDSNS
LEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Coupling of Ca2+and voltage activation in BK channels through the alpha B helix/voltage sensor interface. Geng, Y., Deng, Z., Zhang, G. et al. Proc Natl Acad Sci U S A (2020) 117:14512-14521. DOI 10.1073/pnas.1908183117 · PubMed

Other PDB entries of the same protein (UniProt Q12791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8V60 2.43 Å, F315A mutant of human Slo1 in presence of EDTA - resting VSD
11DA 2.57 Å, Human Slo1-PenitremA complex under divalent chelated condition - full model
9CZM 2.57 Å, Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in nanodisc.
11DC 2.58 Å, Human Slo1-PenitremA complex under divalent chelated condition - gating-ring masked out
11CZ 2.6 Å, Human Slo1-paxilline complex under divalent chelated condition - full model
8V64 2.6 Å, RCK1-RCK2 double mutant of human Slo1 in presence of EDTA - resting VSD
8GHF 2.7 Å, cryo-EM structure of hSlo1 in plasma membrane vesicles
11DB 2.71 Å, Human Slo1-Paxilline complex under divalent chelated condition - gating-ring masked
8V63 2.72 Å, R207A mutant of human Slo1 in presence of EDTA - activated VSD
9JO3 2.8 Å, Cryo-EM structure of human BKca channel-compound 10b complex
8VAZ 2.82 Å, Structure of human Slo1 and human LRRC26 in EDTA - LRRD masked
9CZO 2.87 Å, Ca2+ bound intermediate state of hSlo1 + beta2N-beta4 channel in nanodisc.

Browse structure collections

About this viewer

MolViewer shows 6V5A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.