8V63: PDB entry 8V63

R207A mutant of human Slo1 in presence of EDTA - activated VSD. Determined by electron microscopy at 2.72 Å resolution. Released 11 Dec 2024.

Method: Electron microscopy
Resolution: 2.72 Å
Organism: Homo sapiens
Chains: 4
Atoms: 31,665
Mol. weight: 551.96 kDa
Ligands: POV, CLR, AJP
Released: 11 Dec 2024

Explore 8V63 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8V63 contains 212 α-helices and 136 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 53 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	22-45	24
α-helix	94-105	12
α-helix	110-133	24
β-strand	139-141	3	1
α-helix	148-168	21
α-helix	174-178	5
α-helix	181-187	7
α-helix	190-199	10
β-strand	201-203	3	1
α-helix	207-214	8
α-helix	217-223	7
α-helix	230-259	30
α-helix	262-264	3
α-helix	274-285	12
α-helix	298-326	29
β-strand	343-349	7	2
α-helix	353-363	11
β-strand	373-378	6	2
α-helix	382-383	2
α-helix	385-393	9
β-strand	398-401	4	2
α-helix	408-413	6
α-helix	416-418	3
β-strand	421-425	5	2
α-helix	433-450	18
β-strand	455-460	6	2
α-helix	464-471	8
β-strand	482-485	4	2
α-helix	486-499	14
α-helix	503-510	8
α-helix	524-531	8
β-strand	535-540	6	3
α-helix	541-542	2
α-helix	543-545	3
β-strand	549	1	4
α-helix	550-559	10
β-strand	564-570	7	3
β-strand	578-581	4	3
β-strand	588	1	4
β-strand	594-599	6	3
α-helix	603-606	4
α-helix	607-610	4
α-helix	613-616	4
α-helix	622-624	3
β-strand	686-687	2	5
β-strand	692	1	6
β-strand	693	1	5
α-helix	700-702	3
β-strand	704	1	7
α-helix	707-712	6
β-strand	719-723	5	7
α-helix	730-731	2
α-helix	735-741	7
β-strand	743	1	6
α-helix	751-753	3
β-strand	754-758	5	7
α-helix	760-766	7
α-helix	767-769	3
β-strand	776-780	5	7
α-helix	786-791	6
α-helix	794-796	3
β-strand	799-803	5	7
α-helix	814-817	4
α-helix	818-827	10
β-strand	831	1	8
β-strand	872	1	8
α-helix	873-875	3
β-strand	878-882	5	7
α-helix	885-891	7
α-helix	903-905	3
α-helix	907-910	4
β-strand	914-916	3	7
α-helix	918-929	12
α-helix	932-941	10
α-helix	947-956	10
α-helix	959-960	2
β-strand	961-962	2	5
α-helix	966-972	7
β-strand	975-981	7	9
β-strand	995	1	10
α-helix	996-1007	12
β-strand	1010-1017	8	9
α-helix	1018-1020	3
β-strand	1031-1035	5	9
β-strand	1042	1	10
β-strand	1047-1054	8	9
α-helix	1055	1

Chain B: 52 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	22-45	24
α-helix	94-105	12
α-helix	110-133	24
β-strand	139-141	3	11
α-helix	148-168	21
α-helix	174-178	5
α-helix	181-187	7
α-helix	190-199	10
β-strand	201-203	3	11
α-helix	207-216	10
α-helix	217-223	7
α-helix	230-259	30
α-helix	262-264	3
α-helix	274-285	12
α-helix	298-326	29
α-helix	336-339	4
β-strand	343-349	7	12
α-helix	353-363	11
β-strand	373-378	6	12
α-helix	382-383	2
α-helix	385-393	9
β-strand	398-401	4	12
α-helix	408-413	6
β-strand	421-425	5	12
α-helix	433-450	18
β-strand	455-460	6	12
α-helix	464-471	8
β-strand	482-485	4	12
α-helix	486-499	14
α-helix	503-510	8
α-helix	524-532	9
β-strand	535-540	6	13
α-helix	541-542	2
α-helix	543-545	3
β-strand	549	1	14
α-helix	550-559	10
β-strand	564-570	7	13
β-strand	578-581	4	13
β-strand	588	1	14
β-strand	594-599	6	13
α-helix	603-606	4
α-helix	607-610	4
α-helix	613-616	4
β-strand	686-687	2	15
β-strand	692	1	16
β-strand	693	1	15
α-helix	700-702	3
β-strand	704	1	17
α-helix	707-712	6
β-strand	719-723	5	17
α-helix	730-731	2
α-helix	735-741	7
β-strand	743	1	16
α-helix	751-753	3
β-strand	754-758	5	17
α-helix	760-766	7
α-helix	767-769	3
β-strand	776-780	5	17
α-helix	786-791	6
α-helix	794-796	3
β-strand	799-803	5	17
α-helix	814-817	4
α-helix	818-827	10
β-strand	831	1	18
β-strand	872	1	18
α-helix	873-875	3
β-strand	878-882	5	17
α-helix	885-891	7
α-helix	903-905	3
α-helix	907-910	4
β-strand	914-916	3	17
α-helix	918-929	12
α-helix	932-941	10
α-helix	947-956	10
α-helix	959-960	2
β-strand	961-962	2	15
α-helix	966-972	7
β-strand	975-981	7	19
β-strand	995	1	20
α-helix	996-1007	12
β-strand	1010-1017	8	19
α-helix	1018-1020	3
β-strand	1031-1035	5	19
β-strand	1042	1	20
β-strand	1047-1054	8	19
α-helix	1055	1

Chain C: 54 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	22-45	24
α-helix	94-105	12
α-helix	110-133	24
β-strand	139-141	3	21
α-helix	148-168	21
α-helix	174-178	5
α-helix	181-187	7
α-helix	190-199	10
β-strand	201-203	3	21
α-helix	207-214	8
α-helix	217-223	7
α-helix	230-259	30
α-helix	262-264	3
α-helix	274-285	12
α-helix	298-326	29
β-strand	343-349	7	22
α-helix	353-363	11
β-strand	373-378	6	22
α-helix	382-383	2
α-helix	385-393	9
β-strand	398-401	4	22
α-helix	408-413	6
α-helix	416-418	3
β-strand	421-425	5	22
α-helix	433-450	18
β-strand	455-460	6	22
α-helix	464-471	8
α-helix	477-479	3
β-strand	482-485	4	22
α-helix	486-499	14
α-helix	503-510	8
α-helix	524-531	8
β-strand	535-540	6	23
α-helix	541-542	2
α-helix	543-545	3
β-strand	549	1	24
α-helix	550-559	10
β-strand	564-570	7	23
β-strand	578-581	4	23
β-strand	588	1	24
β-strand	594-599	6	23
α-helix	603-606	4
α-helix	607-610	4
α-helix	613-616	4
α-helix	622-624	3
β-strand	686-687	2	25
β-strand	692	1	26
β-strand	693	1	25
α-helix	700-702	3
β-strand	704	1	27
α-helix	707-712	6
β-strand	719-723	5	27
α-helix	730-731	2
α-helix	735-741	7
β-strand	743	1	26
α-helix	751-753	3
β-strand	754-758	5	27
α-helix	760-766	7
α-helix	767-769	3
β-strand	776-780	5	27
α-helix	786-791	6
α-helix	794-796	3
β-strand	799-803	5	27
α-helix	814-817	4
α-helix	818-827	10
β-strand	831	1	28
β-strand	872	1	28
α-helix	873-875	3
β-strand	878-882	5	27
α-helix	885-890	6
α-helix	903-905	3
α-helix	907-910	4
β-strand	914-916	3	27
α-helix	918-929	12
α-helix	932-941	10
α-helix	947-956	10
α-helix	959-960	2
β-strand	961-962	2	25
α-helix	966-972	7
β-strand	975-981	7	29
β-strand	995	1	30
α-helix	996-1007	12
β-strand	1010-1017	8	29
α-helix	1018-1020	3
β-strand	1031-1035	5	29
β-strand	1042	1	30
β-strand	1047-1054	8	29
α-helix	1055	1

Chain D: 53 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	22-45	24
α-helix	94-105	12
α-helix	110-133	24
β-strand	139-141	3	31
α-helix	148-168	21
α-helix	174-178	5
α-helix	181-187	7
α-helix	190-199	10
β-strand	201-203	3	31
α-helix	207-216	10
α-helix	217-223	7
α-helix	230-259	30
α-helix	262-264	3
α-helix	274-285	12
α-helix	298-326	29
β-strand	343-349	7	32
α-helix	353-363	11
β-strand	373-378	6	32
α-helix	385-393	9
β-strand	398-401	4	32
α-helix	408-413	6
α-helix	416-418	3
β-strand	421-425	5	32
α-helix	433-450	18
β-strand	455-460	6	32
α-helix	464-471	8
α-helix	477-479	3
β-strand	482-485	4	32
α-helix	486-499	14
α-helix	503-508	6
α-helix	524-531	8
β-strand	535-540	6	33
α-helix	541-542	2
α-helix	543-545	3
β-strand	549	1	34
α-helix	550-559	10
β-strand	564-570	7	33
β-strand	578-581	4	33
β-strand	588	1	34
β-strand	594-599	6	33
α-helix	603-606	4
α-helix	607-610	4
α-helix	613-616	4
α-helix	622-624	3
β-strand	686-687	2	35
β-strand	692	1	36
β-strand	693	1	35
α-helix	700-702	3
β-strand	704	1	37
α-helix	707-712	6
β-strand	719-724	6	37
α-helix	730-731	2
α-helix	735-741	7
β-strand	743	1	36
α-helix	751-753	3
β-strand	754-758	5	37
α-helix	760-766	7
α-helix	767-769	3
β-strand	776-780	5	37
α-helix	786-791	6
α-helix	794-796	3
β-strand	799-804	6	37
α-helix	814-817	4
α-helix	818-827	10
β-strand	831	1	38
β-strand	872	1	38
α-helix	873-875	3
β-strand	878-882	5	37
α-helix	885-891	7
α-helix	903-905	3
α-helix	907-910	4
β-strand	914-916	3	37
α-helix	918-929	12
α-helix	932-941	10
α-helix	947-956	10
α-helix	959-960	2
β-strand	961-962	2	35
α-helix	966-972	7
β-strand	975-981	7	39
β-strand	995	1	40
α-helix	996-1007	12
β-strand	1010-1017	8	39
α-helix	1018-1020	3
β-strand	1031-1035	5	39
β-strand	1042	1	40
β-strand	1047-1054	8	39
α-helix	1055	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-activated potassium channel subunit alpha-1	A, B, C, D	protein	1065	Homo sapiens	Q12791 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8V63_1 Calcium-activated potassium channel subunit alpha-1 (chains A, B, C, D)
MDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKT
KEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVF
ALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLE
VNSVVDFFTVPPVFVSVYLNRSWLGLAFLRALRLIQFSEILQFLNILKTSNSIKLVNLLS
IFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLG
RLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFL
KDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESAD
ACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEG
DDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEY
LSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIAS
DAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSP
KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVV
VCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILP
GTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQ
ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPD
TELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALR
GGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA
HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDSNSLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	28
CLR	Cholesterol	C27 H46 O	4
AJP	Digitonin	C56 H92 O29	40

Water and common crystallization additives (K) are not listed.

Primary citation

R207A mutant of human Slo1 in presence of EDTA - activated VSD. Pal, K., Kallure, G.S., Chowdhury, S. To be published.

Other PDB entries of the same protein (UniProt Q12791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V5A 2.0 Å, Crystal structure of the human BK channel gating ring L390P mutant
8V60 2.43 Å, F315A mutant of human Slo1 in presence of EDTA - resting VSD
11DA 2.57 Å, Human Slo1-PenitremA complex under divalent chelated condition - full model
9CZM 2.57 Å, Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in nanodisc.
11DC 2.58 Å, Human Slo1-PenitremA complex under divalent chelated condition - gating-ring masked out
11CZ 2.6 Å, Human Slo1-paxilline complex under divalent chelated condition - full model
8V64 2.6 Å, RCK1-RCK2 double mutant of human Slo1 in presence of EDTA - resting VSD
8GHF 2.7 Å, cryo-EM structure of hSlo1 in plasma membrane vesicles
11DB 2.71 Å, Human Slo1-Paxilline complex under divalent chelated condition - gating-ring masked
9JO3 2.8 Å, Cryo-EM structure of human BKca channel-compound 10b complex
8VAZ 2.82 Å, Structure of human Slo1 and human LRRC26 in EDTA - LRRD masked
9CZO 2.87 Å, Ca2+ bound intermediate state of hSlo1 + beta2N-beta4 channel in nanodisc.

Browse structure collections

About this viewer

MolViewer shows 8V63 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.