6VEE: TTD and linker region of mouse UHRF1

Solution structure of the TTD and linker region of mouse UHRF1 (NP95). Determined by solution NMR. Released 17 Jun 2020.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,500
Mol. weight: 21.69 kDa
Released: 17 Jun 2020

Explore 6VEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6VEE contains 7 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	131	1	1
β-strand	135	1	2
β-strand	136-140	5	3
β-strand	147-156	10	3
α-helix	172-174	3
β-strand	179-184	6	3
α-helix	188-190	3
β-strand	193-196	4	3
α-helix	197-199	3
β-strand	200-202	3	3
α-helix	203-204	2
α-helix	210-212	3
β-strand	218-223	6	3
β-strand	233-245	13	3
β-strand	248-257	10	3
β-strand	261-267	7	3
β-strand	274-276	3	3
α-helix	277-279	3
β-strand	284	1	1
β-strand	287	1	2
α-helix	288	1
β-strand	289	1	4
β-strand	292	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A	protein	187	Mus musculus	Q8VDF2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6VEE_1 E3 ubiquitin-protein ligase UHRF1 (chains A)
GHMVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDI
MYHVKYDDYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVE
ICRKRQTRTARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQPPPALR
NTGKSGP

Primary citation

Alternative splicing and allosteric regulation modulate the chromatin binding of UHRF1. Tauber, M., Kreuz, S., Lemak, A. et al. Nucleic Acids Res (2020) 48:7728-7747. DOI 10.1093/nar/gkaa520 · PubMed

Other PDB entries of the same protein (UniProt Q8VDF2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FDE 1.41 Å, Mouse UHRF1 SRA domain bound with hemi-methylated CpG DNA, crystal structure in space…
2ZKD 1.6 Å, Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
2ZKG 1.77 Å, Crystal structure of unliganded SRA domain of mouse Np95
2ZO1 1.96 Å, Mouse NP95 SRA domain DNA specific complex 2
3F8J 1.99 Å, Mouse UHRF1 SRA domain bound with hemi-methylated CpG, crystal structure in space group…
2ZO0 2.19 Å, mouse NP95 SRA domain DNA specific complex 1
3F8I 2.29 Å, Mouse UHRF1 SRA domain bound with hemi-methylated CpG, crystal structure in space group…
2ZKF 2.55 Å, Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
2ZKE 2.6 Å, Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
6M2V 3.0 Å, Crystal structure of UHRF1 SRA complexed with fully-mCHG DNA.
2ZO2 3.09 Å, Mouse NP95 SRA domain non-specific DNA complex
24MC 3.4 Å, Structure of oocyte cytoplasmic lattices

Browse structure collections

About this viewer

MolViewer shows 6VEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.