6VFO: PHD of mouse UHRF1

Solution structure of the PHD of mouse UHRF1 (NP95). Determined by solution NMR. Released 17 Jun 2020.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 600
Mol. weight: 8.89 kDa
Ligands: ZN
Released: 17 Jun 2020

Explore 6VFO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6VFO contains 5 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	319-321	3
β-strand	323	1	1
β-strand	328	1	1
α-helix	332-334	3
β-strand	335-338	4	2
β-strand	343-346	4	2
α-helix	347-349	3
α-helix	353-354	2
α-helix	366-368	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A	protein	78	Mus musculus	Q8VDF2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6VFO_1 E3 ubiquitin-protein ligase UHRF1 (chains A)
SGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCLKPPLTSVPPEPE
WYCPSCRTDSSEVVQAGE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Alternative splicing and allosteric regulation modulate the chromatin binding of UHRF1. Tauber, M., Kreuz, S., Lemak, A. et al. Nucleic Acids Res (2020) 48:7728-7747. DOI 10.1093/nar/gkaa520 · PubMed

Other PDB entries of the same protein (UniProt Q8VDF2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FDE 1.41 Å, Mouse UHRF1 SRA domain bound with hemi-methylated CpG DNA, crystal structure in space…
2ZKD 1.6 Å, Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
2ZKG 1.77 Å, Crystal structure of unliganded SRA domain of mouse Np95
2ZO1 1.96 Å, Mouse NP95 SRA domain DNA specific complex 2
3F8J 1.99 Å, Mouse UHRF1 SRA domain bound with hemi-methylated CpG, crystal structure in space group…
2ZO0 2.19 Å, mouse NP95 SRA domain DNA specific complex 1
3F8I 2.29 Å, Mouse UHRF1 SRA domain bound with hemi-methylated CpG, crystal structure in space group…
2ZKF 2.55 Å, Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
2ZKE 2.6 Å, Crystal structure of the SRA domain of mouse Np95 in complex with hemi-methylated CpG DNA
6M2V 3.0 Å, Crystal structure of UHRF1 SRA complexed with fully-mCHG DNA.
2ZO2 3.09 Å, Mouse NP95 SRA domain non-specific DNA complex
24MC 3.4 Å, Structure of oocyte cytoplasmic lattices

Browse structure collections

About this viewer

MolViewer shows 6VFO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.