6VU0: PEP-protein phosphotransferase system enzyme I

Name: PDB 6VU0: Crystal structure of the C-terminal domain of enzyme I of the bacterial phosphotransferase system from the escherichia coli enzyme
Published: 2020-06-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of the C-terminal domain of enzyme I of the bacterial phosphotransferase system from the escherichia coli enzyme. Determined by X-ray diffraction at 3.5 Å resolution. Released 17 Jun 2020.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Escherichia coli
Chains: 2
Atoms: 4,858
Mol. weight: 70.89 kDa
Released: 17 Jun 2020

Explore 6VU0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6VU0 contains 42 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	262	1	1
β-strand	268	1	1
β-strand	270-275	6	2
α-helix	278-286	9
β-strand	292-296	5	2
α-helix	298-301	4
α-helix	307-309	3
α-helix	310-324	15
β-strand	328-332	5	2
α-helix	343-345	3
α-helix	347-349	3
α-helix	353-355	3
α-helix	360-365	6
α-helix	367-380	14
α-helix	381-383	3
β-strand	385-390	6	2
α-helix	396-416	21
β-strand	425-428	4	2
α-helix	433-437	5
α-helix	439-443	5
β-strand	448-450	3	2
α-helix	453-461	9
α-helix	471-473	3
α-helix	479-494	16
β-strand	498-501	4	2
α-helix	504-507	4
α-helix	509-517	9
β-strand	522-526	5	2
α-helix	527-529	3
α-helix	530-538	9
α-helix	542-552	11
α-helix	558-569	12

Chain B: 20 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	262	1	3
β-strand	268	1	3
β-strand	270-275	6	4
α-helix	281-286	6
β-strand	292-296	5	4
α-helix	298-301	4
α-helix	310-324	15
β-strand	328-332	5	4
α-helix	343-345	3
α-helix	347-349	3
α-helix	353-355	3
α-helix	359-365	7
α-helix	368-380	13
α-helix	381-383	3
β-strand	385-390	6	4
α-helix	396-415	20
β-strand	425-428	4	4
α-helix	433-437	5
α-helix	439-443	5
β-strand	448-451	4	4
α-helix	453-461	9
α-helix	471-473	3
α-helix	479-494	16
β-strand	498-501	4	4
α-helix	504-507	4
α-helix	509-517	9
β-strand	522-525	4	4
α-helix	530-538	9
α-helix	542-552	11
α-helix	558-568	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PEP-protein phosphotransferase system enzyme I	A, B	protein	316	Escherichia coli	P08839 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6VU0_1 PEP-protein phosphotransferase system enzyme I (chains A, B)
MAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKA
VAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAIRIAMDRREILRDQLRAILR
ASAFGKLRIMFPMIISVEEVRALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIA
RHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWT
GMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTD
ELMTLVNKFIEEKTIC

Primary citation

Hybrid Thermophilic/Mesophilic Enzymes Reveal a Role for Conformational Disorder in Regulation of Bacterial Enzyme I. Dotas, R.R., Nguyen, T.T., Stewart Jr., C.E. et al. J Mol Biol (2020) 432:4481-4498. DOI 10.1016/j.jmb.2020.05.024 · PubMed

Other PDB entries of the same protein (UniProt P08839 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V9K 1.9 Å, Crystal structure of the hybrid C-terminal domain of enzyme I of the bacterial…
1ZYM 2.5 Å, Amino terminal domain of enzyme I from escherichia coli
2HWG 2.7 Å, Structure of phosphorylated Enzyme I of the phosphoenolpyruvate:sugar phosphotransferase…
1EZA Amino terminal domain of enzyme I from escherichia coli NMR, restrained regularized mean…
1EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZD Amino terminal domain of enzyme I from escherichia coli NMR, 16 structures
2EZA Amino terminal domain of enzyme I from escherichia coli, NMR, restrained regularized…
2EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2KX9 Solution Structure of the Enzyme I dimer Using Residual Dipolar Couplings and Small…
2L5H Solution Structure of the H189Q mutant of the Enzyme I dimer Using Residual Dipolar…

Browse structure collections

About this viewer

MolViewer shows 6VU0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.