6W3H: ATV Fc

Brain delivery of therapeutic proteins using an Fc fragment blood-brain barrier transport vehicle in mice and monkeys. Determined by X-ray diffraction at 3.38 Å resolution. Released 10 Jun 2020.

Method: X-ray diffraction
Resolution: 3.38 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,251
Mol. weight: 88.38 kDa
Released: 10 Jun 2020

Explore 6W3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W3H contains 29 α-helices and 61 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	240-243	4	1
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-263	6	1
β-strand	274-279	6	2
β-strand	282-284	3	2
β-strand	288-289	2	1
α-helix	290-292	3
β-strand	293-294	2	3
β-strand	300-301	2	3
β-strand	302-307	6	1
α-helix	310-315	6
β-strand	319-324	6	2
β-strand	332-336	5	2
β-strand	344	1	4
α-helix	345-346	2
β-strand	347-351	5	5
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	5
β-strand	373	1	4
β-strand	378-383	6	6
β-strand	386-387	2	6
β-strand	388	1	7
β-strand	391-393	3	5
α-helix	394-396	3
β-strand	397-398	2	5
β-strand	404-413	10	5
α-helix	414-418	5
β-strand	423-428	6	6
α-helix	433-435	3
β-strand	437-441	5	6

Chain B: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	240-243	4	12
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-263	6	12
β-strand	274-279	6	13
β-strand	282-284	3	13
β-strand	303-307	5	12
α-helix	310-315	6
β-strand	319-324	6	13
β-strand	332-336	5	13
α-helix	339-340	2
β-strand	344	1	14
α-helix	345-346	2
β-strand	347-351	5	15
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	15
β-strand	373	1	14
β-strand	378-383	6	16
β-strand	386-387	2	16
β-strand	388	1	10
β-strand	391-393	3	15
α-helix	394-396	3
β-strand	397-398	2	15
β-strand	404-413	10	15
α-helix	414-418	5
β-strand	423-428	6	16
α-helix	433-435	3
β-strand	437-441	5	16

Chain C: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	8
α-helix	35-42	8
β-strand	45-48	4	9
α-helix	49-50	2
β-strand	60-63	4	9
β-strand	68-73	6	10
α-helix	77-79	3
β-strand	81-85	5	10
β-strand	91-96	6	10
β-strand	108-112	5	10
β-strand	114-116	3	8
α-helix	122-126	5
β-strand	136-140	5	8
α-helix	146-155	10
β-strand	160-164	5	8

Chain D: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	11
α-helix	35-42	8
β-strand	45-46	2	11
β-strand	62-63	2	11
β-strand	67-73	7	7
α-helix	77-79	3
β-strand	81-86	6	7
β-strand	91-96	6	7
β-strand	108-112	5	7
β-strand	114-116	3	11
α-helix	122-126	5
β-strand	136-140	5	11
α-helix	146-155	10
β-strand	160-164	5	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATV Fc	A, B	protein	227	Homo sapiens
Transferrin receptor protein 1,Transferrin receptor protein 1	C, D	protein	166	Homo sapiens	P02786 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6W3H_1 ATV Fc (chains A, B)
DKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESYGTEWSSYKTTPPVLDS
DGSFFLYSKLTVTKSEWQQGFVFSCSVMHEALHNHYTQKSLSLSPGK

Sequence of entity 2 (C, D), FASTA

>6W3H_2 Transferrin receptor protein 1,Transferrin receptor protein 1 (chains C, D)
TSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNDSAQN
SVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVR
AGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSASHHHHHH

Primary citation

Brain delivery of therapeutic proteins using an Fc fragment blood-brain barrier transport vehicle in mice and monkeys. Kariolis, M.S., Wells, R.C., Getz, J.A. et al. Sci Transl Med (2020) 12. DOI 10.1126/scitranslmed.aay1359 · PubMed

Other PDB entries of the same protein (UniProt P02786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OKD 1.85 Å, Crystal Structure of human transferrin receptor in complex with a cystine-dense peptide
8P0Z 1.88 Å, AP01-S2.3 - a variant of a redesigned transferrin receptor apical domain
6Y76 1.98 Å, AP01 - a redesigned transferrin receptor apical domain
9GH7 2.08 Å, Complex of human TfR1 with a potent bicyclic peptide
11QC 2.4 Å, Human transferrin receptor ectodomain
11RN 2.4 Å, Complex of B19V VP1u RBD and human transferrin receptor ectodomain
3KAS 2.4 Å, Machupo virus GP1 bound to human transferrin receptor 1
6WRV 2.47 Å, Crystal structure of computationally designed protein 3DS18 in complex with the human…
7ZQS 2.54 Å, Cryo-EM Structure of Human Transferrin Receptor 1 bound to DNA Aptamer
1DE4 2.8 Å, Hemochromatosis protein hfe complexed with transferrin receptor
6WRW 2.84 Å, Crystal structure of computationally designed protein 2DS25.5 in complex with the human…
6WRX 3.07 Å, Crystal structure of computationally designed protein 2DS25.1 in complex with the human…

Browse structure collections

About this viewer

MolViewer shows 6W3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.