6W66: F64A, S172A mutant Keap1-BTB domain

The structure of the F64A, S172A mutant Keap1-BTB domain in complex with SKP1-FBXL17. Determined by X-ray diffraction at 3.21 Å resolution. Released 19 Aug 2020.

Method: X-ray diffraction
Resolution: 3.21 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,219
Mol. weight: 78.51 kDa
Released: 19 Aug 2020

Explore 6W66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W66 contains 37 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	13-16	4	1
α-helix	18-21	4
α-helix	25-34	10
α-helix	43-44	2
β-strand	45-46	2	1
α-helix	52-64	13
α-helix	68-70	3
α-helix	87-92	6
α-helix	97-109	13
α-helix	113-127	15
α-helix	132-139	8
α-helix	149-156	8

Chain B: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	321-323	3
α-helix	326-334	9
α-helix	338-342	5
α-helix	345-347	3
α-helix	350-357	8
β-strand	365-366	2	2
α-helix	370-372	3
α-helix	376-384	9
β-strand	390-392	3	2
α-helix	401-410	10
β-strand	416-418	3	2
α-helix	427-436	10
β-strand	442-444	3	2
α-helix	456-462	7
β-strand	468-472	5	2
α-helix	479-487	9
β-strand	494-498	5	2
α-helix	505-512	8
β-strand	520-524	5	2
α-helix	530-533	4
α-helix	534-538	5
β-strand	544-546	3	2
α-helix	555-564	10
β-strand	570-572	3	2
α-helix	581-590	10
β-strand	596-598	3	2
α-helix	606-615	10
β-strand	621-623	3	2
α-helix	632-641	10
β-strand	647-649	3	2
α-helix	658-667	10
β-strand	672-674	3	2
α-helix	676-688	13

Chain C: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	51-55	5	3
α-helix	59-61	3
α-helix	63-72	10
β-strand	79-83	5	4
β-strand	91-95	5	4
α-helix	97-103	7
α-helix	105-111	7
β-strand	121-125	5	4
α-helix	130-142	13
β-strand	144-148	5	3
α-helix	152-162	11
α-helix	165-177	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-phase kinase-associated protein 1	A	protein	163	Homo sapiens	P63208 (AlphaFold model)
F-box/LRR-repeat protein 17	B	protein	396	Homo sapiens	Q9UF56 (AlphaFold model)
Kelch-like ECH-associated protein 1	C	protein	134	Homo sapiens	Q14145 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6W66_1 S-phase kinase-associated protein 1 (chains A)
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Sequence of entity 2 (B), FASTA

>6W66_2 F-box/LRR-repeat protein 17 (chains B)
GEFMCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQFWKQL
DLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAYRCKQL
SDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVI
AKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSL
DLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKIT
DYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLV
QQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS

Sequence of entity 3 (C), FASTA

>6W66_3 Kelch-like ECH-associated protein 1 (chains C)
GGNRTFSYTLEDHTKQAAGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPV
FKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDS
VVRACADFLVQQLD

Primary citation

Structural basis for dimerization quality control. Mena, E.L., Jevtic, P., Greber, B.J. et al. Nature (2020) 586:452-456. DOI 10.1038/s41586-020-2636-7 · PubMed

Other PDB entries of the same protein (UniProt P63208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FS1 1.8 Å, Insights into scf ubiquitin ligases from the structure of the SKP1-SKP2 complex
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
2AST 2.3 Å, Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
2OVR 2.5 Å, Structure of the Skp1-Fbw7-CyclinEdegN complex
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6WNX 2.5 Å, FBXW11-SKP1 in complex with a pSer33/pSer37 Beta-Catenin peptide
5IBK 2.5 Å, Skp1-F-box in complex with a ubiquitin variant
6O60 2.5 Å, Crystal structure of GGTase3-FBXL2-SKP1 complex
5JH5 2.55 Å, Structural Basis for the Hierarchical Assembly of the Core of PRC1.1

Browse structure collections

About this viewer

MolViewer shows 6W66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.