2OVR: Skp1-Fbw7-CyclinEdegN complex

Structure of the Skp1-Fbw7-CyclinEdegN complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 24 Apr 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,907
Mol. weight: 69.24 kDa
Released: 24 Apr 2007

Explore 2OVR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OVR contains 18 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1003-1008	6	1
β-strand	1013-1017	5	1
α-helix	1021-1023	3
α-helix	1025-1029	5
α-helix	1030-1034	5
β-strand	1045-1047	3	1
α-helix	1052-1063	12
α-helix	1087-1092	6
α-helix	1099-1110	12
α-helix	1113-1124	12
α-helix	1132-1139	8
α-helix	1147-1156	10

Chain B: 9 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	2265-2272	8
α-helix	2286-2293	8
α-helix	2298-2304	7
α-helix	2309-2315	7
α-helix	2319-2325	7
α-helix	2350-2367	18
α-helix	2371-2373	3
β-strand	2374-2377	4	2
β-strand	2384-2390	7	3
β-strand	2393-2398	6	3
β-strand	2403-2407	5	3
β-strand	2413-2416	4	3
β-strand	2424-2430	7	4
β-strand	2433-2438	6	4
β-strand	2443-2447	5	4
β-strand	2452-2457	6	4
β-strand	2464-2470	7	5
β-strand	2473-2478	6	5
β-strand	2482-2487	6	5
β-strand	2493-2498	6	5
β-strand	2504-2509	6	6
β-strand	2514-2518	5	6
β-strand	2523-2527	5	6
α-helix	2528-2530	3
β-strand	2532-2537	6	6
β-strand	2544-2549	6	7
β-strand	2553-2558	6	7
β-strand	2563-2567	5	7
β-strand	2573-2577	5	7
β-strand	2584-2590	7	8
β-strand	2593-2598	6	8
β-strand	2603-2607	5	8
β-strand	2613-2617	5	8
β-strand	2627-2632	6	9
β-strand	2636-2641	6	9
β-strand	2645-2650	6	9
β-strand	2656-2662	7	9
α-helix	2666-2668	3
β-strand	2671-2677	7	2
β-strand	2681-2687	7	2
β-strand	2696-2701	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-phase kinase-associated protein 1A	A	protein	149	Homo sapiens	P63208 (AlphaFold model)
F-box/WD repeat protein 7	B	protein	445	Homo sapiens	Q969H0 (AlphaFold model)
cyclinE N-terminal degron	C	protein	8

Sequence of entity 1 (A), FASTA

>2OVR_1 S-phase kinase-associated protein 1A (chains A)
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDPVPLPNVNAAILKKVIQWCTHHK
DDPGGSGTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEE
IRKTFNIKNDFTEEEEAQVRKENQWCEEK

Sequence of entity 2 (B), FASTA

>2OVR_2 F-box/WD repeat protein 7 (chains B)
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWR
EKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDH
VITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRT
LKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVA
AVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTS
IRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNK
HQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKL
VCAVGSRNGTEETKLLVLDFDVDMK

Sequence of entity 3 (C), FASTA

>2OVR_3 cyclinE N-terminal degron (chains C)
SLIPTPDK

Primary citation

Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases. Hao, B., Oehlmann, S., Sowa, M.E. et al. Mol Cell (2007) 26:131-143. DOI 10.1016/j.molcel.2007.02.022 · PubMed

Other PDB entries of the same protein (UniProt P63208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FS1 1.8 Å, Insights into scf ubiquitin ligases from the structure of the SKP1-SKP2 complex
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
2AST 2.3 Å, Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6WNX 2.5 Å, FBXW11-SKP1 in complex with a pSer33/pSer37 Beta-Catenin peptide
5IBK 2.5 Å, Skp1-F-box in complex with a ubiquitin variant
6O60 2.5 Å, Crystal structure of GGTase3-FBXL2-SKP1 complex
5JH5 2.55 Å, Structural Basis for the Hierarchical Assembly of the Core of PRC1.1
7T1Y 2.55 Å, Structure of the Fbw7-Skp1-MycCdegron complex

Browse structure collections

About this viewer

MolViewer shows 2OVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.