6W8P: Membrane protein with ions

Name: PDB 6W8P: Structure of membrane protein with ions
Published: 2021-08-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Structure of membrane protein with ions. Determined by electron microscopy at 3.6 Å resolution. Released 4 Aug 2021.

Method: Electron microscopy
Resolution: 3.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,509
Mol. weight: 111.45 kDa
Released: 4 Aug 2021

Explore 6W8P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W8P contains 52 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	35-47	13
α-helix	50-52	3
α-helix	53-57	5
α-helix	67-100	34
α-helix	107-120	14
α-helix	123-132	10
α-helix	137-162	26
α-helix	165-168	4
α-helix	172-175	4
α-helix	181-201	21
α-helix	212-223	12
α-helix	254-257	4
α-helix	258-273	16
α-helix	277-283	7
α-helix	288-291	4
α-helix	293-295	3
α-helix	299-303	5
α-helix	304-306	3
α-helix	307-331	25
α-helix	339-362	24
α-helix	374-395	22
α-helix	416-434	19
α-helix	435-438	4
α-helix	444-469	26

Chain B: 28 helices, 0 β-strands

Element	Residues	Length
α-helix	35-49	15
α-helix	50-52	3
α-helix	53-56	4
α-helix	67-101	35
α-helix	107-121	15
α-helix	123-131	9
α-helix	137-162	26
α-helix	165-168	4
α-helix	172-175	4
α-helix	181-205	25
α-helix	213-219	7
α-helix	220-228	9
α-helix	254-257	4
α-helix	258-282	25
α-helix	288-291	4
α-helix	293-295	3
α-helix	300-303	4
α-helix	304-306	3
α-helix	307-331	25
α-helix	339-362	24
α-helix	374-394	21
α-helix	395-397	3
α-helix	400-402	3
α-helix	416-434	19
α-helix	435-438	4
α-helix	444-454	11
α-helix	455-458	4
α-helix	459-469	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endosomal/lysosomal potassium channel TMEM175	A, B	protein	504	Homo sapiens	Q9BSA9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6W8P_1 Endosomal/lysosomal potassium channel TMEM175 (chains A, B)
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI
SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI
TFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL
YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP
SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV
AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQ
QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF
AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA
RPEHPPPAPTGQDDPQSQLLPAPC

Primary citation

Structure of membrane protein with ions. Shen, C., Fu, T.M., Wang, L.F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9BSA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UNL 2.45 Å, Human TMEM175 in an open state
7UNM 2.61 Å, Human TMEM175 in an closed state
6WC9 2.64 Å, Human open state TMEM175 in KCl
8DHM 2.73 Å, Human TMEM175 in complex with 4-aminopyridine
9VSQ 2.74 Å, The TUG-891-bound structure of TMEM175
9VSR 2.92 Å, The DCY1040 and TUG-891-bound structure of TMEM175
6WCA 3.03 Å, Human closed state TMEM175 in KCl
6WCB 3.17 Å, Human open state TMEM175 in CsCl
6W8N 3.2 Å, Structure of a trans-membrane protein
6WCC 3.24 Å, Human closed state TMEM175 in CsCl
6W8O 3.4 Å, Structure of an Apo membrane protein
8FYF 3.4 Å, Human TMEM175-LAMP1 transmembrane domain only complex

Browse structure collections

About this viewer

MolViewer shows 6W8P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.