6W9W: R80A PCNA mutant defective in BIR

R80A PCNA mutant defective in BIR. Determined by X-ray diffraction at 2.65 Å resolution. Released 23 Sept 2020.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,010
Mol. weight: 28.65 kDa
Released: 23 Sept 2020

Explore 6W9W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W9W contains 10 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	9-19	11
β-strand	25-31	7	2
β-strand	34-40	7	2
β-strand	46-53	8	2
α-helix	54-56	3
β-strand	59-62	4	1
β-strand	66-71	6	2
α-helix	72-79	8
β-strand	87-92	6	1
β-strand	98-104	7	1
β-strand	111-117	7	1
α-helix	118	1
β-strand	119	1	2
α-helix	120	1
β-strand	135-140	6	2
α-helix	141-152	12
β-strand	157-163	7	3
β-strand	166-172	7	3
β-strand	177-182	6	3
β-strand	185	1	4
α-helix	191-193	3
β-strand	195	1	4
β-strand	196-199	4	2
β-strand	203-208	6	3
α-helix	209-215	7
α-helix	216-220	5
β-strand	224-229	6	2
β-strand	235-241	7	2
β-strand	244-250	7	2
α-helix	251-253	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proliferating cell nuclear antigen	A	protein	256	Saccharomyces cerevisiae	P15873 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6W9W_1 Proliferating cell nuclear antigen (chains A)
HHMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQ
EYRCDHPVTLGMDLTSLSKILACGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKL
MDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSG
SVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQ
FDLKSGFLQFFLAPKF

Primary citation

Structural analysis of PCNA mutant proteins defective in BIR, FF248-249AA and R80A. Ripley, B.M., Washington, M.T. To be published.

Other PDB entries of the same protein (UniProt P15873 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V7M 1.93 Å, PCNA mutant L126A/I128A Protein Defective in Gene Silencing
8DQX 2.1 Å, Open state of RFC:PCNA bound to a 3' ss/dsDNA junction
8DR1 2.14 Å, Consensus closed state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2)
8DR3 2.2 Å, Closed state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2) with NTD
1PLQ 2.3 Å, Crystal structure of the eukaryotic DNA polymerase processivity factor pcna
8DR6 2.39 Å, Closed state of RFC:PCNA bound to a nicked dsDNA
8DR0 2.42 Å, Closed state of RFC:PCNA bound to a 3' ss/dsDNA junction
8DR4 2.45 Å, Open state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2) without NTD
3GPN 2.5 Å, Structure of the non-trimeric form of the E113G PCNA mutant protein
3V60 2.6 Å, Structure of S. cerevisiae PCNA conjugated to SUMO on lysine 164
8THW 2.6 Å, Cac1 PIP motif bound to PCNA
4L6P 2.68 Å, Structure of C22Y Mutant PCNA protein defective in DNA mismatch repair

Browse structure collections

About this viewer

MolViewer shows 6W9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.