6WAU: Complex structure of PHF19

Complex structure of PHF19. Determined by X-ray diffraction at 1.75 Å resolution. Released 26 Aug 2020.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 12
Atoms: 3,090
Mol. weight: 48.92 kDa
Released: 26 Aug 2020

Explore 6WAU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WAU contains 8 α-helices and 36 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	45-49	5	1
β-strand	55-64	10	1
β-strand	69-73	5	1
β-strand	79-83	5	1
α-helix	84-86	3
β-strand	87-89	3	1

Chain E: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	45-49	5	5
β-strand	55-64	10	5
β-strand	69-74	6	5
β-strand	79-83	5	5
α-helix	84-86	3
β-strand	87-89	3	5

Chain F: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	45-49	5	6
α-helix	50	1
β-strand	55-64	10	6
β-strand	69-74	6	6
β-strand	79-83	5	6
α-helix	84-86	3
β-strand	87-89	3	6

Chains G, H, I, J and K: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	24	1	1

Chain L: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	24	1	6
α-helix	25-26	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 19	A, B, C, D, E, F	protein	60	Homo sapiens	Q5T6S3 (AlphaFold model)
Histone H3.1t peptide	G, H, I, J, K, L	protein	12	Homo sapiens	Q16695 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>6WAU_1 PHD finger protein 19 (chains A, B, C, D, E, F)
GSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEE

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>6WAU_2 Histone H3.1t peptide (chains G, H, I, J, K, L)
ATKVARKSAPAT

Primary citation

Structural basis for histone variant H3tK27me3 recognition by PHF1 and PHF19. Dong, C., Nakagawa, R., Oyama, K. et al. Elife (2020) 9. DOI 10.7554/eLife.58675 · PubMed

Other PDB entries of the same protein (UniProt Q5T6S3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XZI 2.69 Å, Crystal Structure of the SUZ12-RBBP4-PHF19-EPOP PRC2.1 Subcomplex
6NQ3 2.89 Å, Crystal Structure of a SUZ12-RBBP4-PHF19-JARID2 Heterotetrameric Complex
2E5Q Solution structure of the TUDOR domain of PHD finger protein 19, isoform b [Homo sapiens]
4BD3 Phf19 links methylated lysine 36 of histone H3 to regulation of Polycomb activity

Browse structure collections

About this viewer

MolViewer shows 6WAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.