6WMQ: Nuclear receptor Rev-ErbA beta variant 1

Name: PDB 6WMQ: Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR ID1 Peptide
Published: 2021-02-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR ID1 Peptide. Determined by X-ray diffraction at 2.55 Å resolution. Released 17 Feb 2021.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,513
Mol. weight: 51.71 kDa
Ligands: HEM
Released: 17 Feb 2021

Explore 6WMQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WMQ contains 21 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	398-421	24
α-helix	425-428	4
α-helix	431-449	19
α-helix	450-453	4
β-strand	454-455	2	1
β-strand	460-462	3	1
β-strand	468-470	3	1
α-helix	471-476	6
α-helix	481-496	16
α-helix	500-512	13
α-helix	522-543	22
α-helix	549-555	7
α-helix	557-573	17
α-helix	574-576	3

Chain B: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	398-420	23
α-helix	431-449	19
α-helix	451-453	3
β-strand	454-455	2	2
β-strand	460-462	3	2
β-strand	468-470	3	2
α-helix	471-476	6
α-helix	481-495	15
α-helix	500-512	13
α-helix	522-543	22
α-helix	549-575	27

Chains E and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2263-2268	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor Rev-ErbA beta variant 1	A, B	protein	199	Homo sapiens	Q14995 (AlphaFold model)
Nuclear receptor corepressor 1	E, F	protein	23	Homo sapiens	O75376 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6WMQ_1 Nuclear receptor Rev-ErbA beta variant 1 (chains A, B)
HLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKA
GTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSD
EEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD
LRSLNNMHSEELLAFKVHP

Sequence of entity 2 (E, F), FASTA

>6WMQ_2 Nuclear receptor corepressor 1 (chains E, F)
RTHRLITLADHICQIITQDFARN

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	2

Primary citation

Structural basis for heme-dependent NCoR binding to the transcriptional repressor REV-ERB beta. Mosure, S.A., Strutzenberg, T.S., Shang, J. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abc6479 · PubMed

Other PDB entries of the same protein (UniProt Q14995 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N73 1.87 Å, Crystal structure of the ligand binding domain (LBD) of REV-ERB beta bound to Cobalt…
3CQV 1.9 Å, Crystal structure of Reverb beta in complex with heme
6WMS 2.0 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…
2V0V 2.4 Å, Crystal Structure of Rev-Erb beta
2V7C 2.4 Å, Crystal Structure of Rev-Erb beta

Browse structure collections

About this viewer

MolViewer shows 6WMQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.