6WNX: FBXW11-SKP1

FBXW11-SKP1 in complex with a pSer33/pSer37 Beta-Catenin peptide. Determined by X-ray diffraction at 2.5 Å resolution. Released 6 May 2020.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 9
Atoms: 13,651
Mol. weight: 201.11 kDa
Released: 6 May 2020

Explore 6WNX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WNX contains 57 α-helices and 95 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	6-12	7
α-helix	16-23	8
α-helix	28-35	8
α-helix	39-47	9
α-helix	50-61	12
α-helix	63-71	9
α-helix	75-77	3
α-helix	89-112	24
β-strand	116-121	6	1
β-strand	130-135	6	2
β-strand	139-144	6	2
β-strand	149-153	5	2
β-strand	159-163	5	2
β-strand	170-175	6	3
β-strand	179-184	6	3
β-strand	188-193	6	3
β-strand	199-204	6	3
β-strand	210-216	7	4
β-strand	219-224	6	4
β-strand	228-234	7	4
β-strand	240-247	8	4
β-strand	253-258	6	5
β-strand	262-267	6	5
β-strand	272-276	5	5
β-strand	282-286	5	5
β-strand	293-299	7	6
β-strand	302-307	6	6
β-strand	312-316	5	6
β-strand	322-326	5	6
β-strand	333-338	6	7
β-strand	342-347	6	7
β-strand	351-356	6	7
α-helix	357-361	5
α-helix	367-369	3
β-strand	371-376	6	7
β-strand	382-388	7	1
β-strand	391-396	6	1
β-strand	400-405	6	1

Chain B: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	13-17	5	8
α-helix	18-21	4
α-helix	25-32	8
β-strand	39-40	2	8
α-helix	46-58	13
α-helix	69-74	6
α-helix	79-92	14
α-helix	95-109	15
α-helix	114-121	8
α-helix	129-139	11
α-helix	140-142	3

Chain D: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	9-12	4
α-helix	16-23	8
α-helix	28-35	8
α-helix	39-47	9
α-helix	50-61	12
α-helix	63-72	10
α-helix	75-77	3
α-helix	89-112	24
β-strand	116-121	6	9
β-strand	130-135	6	10
β-strand	139-144	6	10
β-strand	149-153	5	10
β-strand	159-163	5	10
β-strand	170-175	6	11
β-strand	179-184	6	11
β-strand	189-193	5	11
β-strand	199-203	5	11
β-strand	210-216	7	12
β-strand	219-224	6	12
β-strand	228-234	7	12
β-strand	240-247	8	12
β-strand	253-258	6	13
β-strand	262-267	6	13
β-strand	272-276	5	13
β-strand	282-286	5	13
β-strand	293-299	7	14
β-strand	302-307	6	14
β-strand	312-316	5	14
β-strand	322-326	5	14
β-strand	333-338	6	15
β-strand	342-347	6	15
β-strand	351-356	6	15
α-helix	357-361	5
α-helix	367-369	3
β-strand	371-376	6	15
β-strand	382-387	6	9
β-strand	391-396	6	9
β-strand	400-405	6	9

Chain E: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	16
β-strand	13-15	3	16
α-helix	18-21	4
α-helix	25-32	8
β-strand	39-41	3	16
α-helix	46-55	10
β-strand	56	1	17
β-strand	58	1	17
α-helix	69-73	5
α-helix	80-92	13
α-helix	97-109	13
α-helix	114-121	8
α-helix	129-138	10

Chain G: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	6-12	7
α-helix	16-23	8
α-helix	28-35	8
α-helix	39-47	9
α-helix	50-61	12
α-helix	63-72	10
α-helix	75-77	3
α-helix	89-112	24
β-strand	116-121	6	18
β-strand	130-135	6	19
β-strand	139-144	6	19
β-strand	149-153	5	19
β-strand	159-163	5	19
β-strand	170-175	6	20
β-strand	179-184	6	20
β-strand	189-193	5	20
β-strand	199-203	5	20
β-strand	210-216	7	21
β-strand	219-224	6	21
β-strand	228-234	7	21
β-strand	240-247	8	21
β-strand	253-258	6	22
β-strand	262-267	6	22
β-strand	272-276	5	22
β-strand	282-286	5	22
β-strand	293-299	7	23
β-strand	302-307	6	23
β-strand	312-316	5	23
β-strand	322-326	5	23
β-strand	333-338	6	24
β-strand	342-347	6	24
β-strand	351-356	6	24
α-helix	357-361	5
α-helix	367-369	3
β-strand	371-376	6	24
β-strand	382-387	6	18
β-strand	391-396	6	18
β-strand	400-405	6	18

Chain H: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	25
β-strand	13-17	5	25
α-helix	18-21	4
α-helix	25-32	8
β-strand	39-41	3	25
α-helix	46-58	13
α-helix	63-66	4
α-helix	70-74	5
α-helix	79-92	14
α-helix	95-109	15
α-helix	114-121	8
α-helix	129-139	11
α-helix	140-142	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box/WD repeat-containing protein 11	A, D, G	protein	429	Homo sapiens	Q9UKB1 (AlphaFold model)
S-phase kinase-associated protein 1	B, E, H	protein	145	Homo sapiens	P63208 (AlphaFold model)
Catenin beta-1	C, F, I	protein	9	Homo sapiens	P35222 (AlphaFold model)

Sequence of entity 1 (A, D, G), FASTA

>6WNX_1 F-box/WD repeat-containing protein 11 (chains A, D, G)
MLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVR
TDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRI
QCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVI
VTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDI
TLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRD
RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA
LDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSP
SRTYTYISR

Sequence of entity 2 (B, E, H), FASTA

>6WNX_2 S-phase kinase-associated protein 1 (chains B, E, H)
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDPVPLPNVNAAILKKVIQWCTHHK
DDPPDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKT
FNIKNDFTEEEEAQVRKENQWCEEK

Sequence of entity 3 (C, F, I), FASTA

>6WNX_3 Catenin beta-1 (chains C, F, I)
LDSGIHSGA

Primary citation

FBXW11-SKP1 in complex with a pSer33/pSer37 Beta-Catenin peptide. Ivanochko, D., Edwards, A.M., Bountra, C. et al. To be published.

Browse structure collections

About this viewer

MolViewer shows 6WNX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.