6WVW: R59P-SNAP25 containing SNARE complex
Crystal structure of the R59P-SNAP25 containing SNARE complex. Determined by X-ray diffraction at 2.11 Å resolution. Released 17 Mar 2021.
- Method
- X-ray diffraction
- Resolution
- 2.11 Å
- Organism
- Rattus norvegicus
- Chains
- 8
- Atoms
- 4,635
- Mol. weight
- 62.09 kDa
- Ligands
- CA
- Released
- 17 Mar 2021
Explore 6WVW in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6WVW contains 8 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-87 | 59 | |
Chains B and F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 192-255 | 64 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-81 | 70 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 142-202 | 61 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-87 | 60 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-81 | 71 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 144-203 | 60 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Vesicle-associated membrane protein 2 | A, E | protein | 63 | Rattus norvegicus | P63045 (AlphaFold model) |
| Syntaxin-1A | B, F | protein | 66 | Rattus norvegicus | P32851 (AlphaFold model) |
| Synaptosomal-associated protein 25 | C, G | protein | 74 | Rattus norvegicus | P60881 (AlphaFold model) |
| Synaptosomal-associated protein 25 | D, H | protein | 64 | Rattus norvegicus | P60881 (AlphaFold model) |
Sequence of entity 1 (A, E), FASTA
>6WVW_1 Vesicle-associated membrane protein 2 (chains A, E)
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKR
KYW
Sequence of entity 2 (B, F), FASTA
>6WVW_2 Syntaxin-1A (chains B, F)
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
TKKAVK
Sequence of entity 3 (C, G), FASTA
>6WVW_3 Synaptosomal-associated protein 25 (chains C, G)
ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDPVEEGMNHINQ
DMKEAEKNLKDLGK
Sequence of entity 4 (D, H), FASTA
>6WVW_4 Synaptosomal-associated protein 25 (chains D, H)
ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRAT
KMLG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 4 |
Water and common crystallization additives (MPD) are not listed.
Primary citation
Role of Aberrant Spontaneous Neurotransmission in SNAP25-Associated Encephalopathies. Alten, B., Zhou, Q., Shin, O.H. et al. Neuron (2021) 109:59-72.e5. DOI 10.1016/j.neuron.2020.10.012 · PubMed
Other PDB entries of the same protein (UniProt P63045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1N7S 1.45 Å, High Resolution Structure of a Truncated Neuronal SNARE Complex
- 5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
- 1KIL 2.3 Å, Three-dimensional structure of the complexin/SNARE complex
- 1SFC 2.4 Å, Neuronal synaptic fusion complex
- 5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
- 6A30 2.79 Å, Crystal Structure of Munc13-1 MUN Domain and Synaptobrevin-2 Juxtamembrane Linker Region
- 3HD7 3.4 Å, Helical extension of the neuronal snare complex into the membrane, spacegroup C 1 2 1
- 5CCG 3.5 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (long unit cell form)
- 7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
- 5CCH 3.6 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (short unit cell form)
- 6IP1 3.9 Å, alpha-SNAP-SNARE subcomplex in the whole 20S complex
- 5CCI 4.1 Å, Structure of the Mg2+-bound synaptotagmin-1 SNARE complex (short unit cell form)
Browse structure collections
About this viewer
MolViewer shows 6WVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.