6WW7: ER membrane protein complex subunit 1

Name: PDB 6WW7: Structure of the human ER membrane protein complex in a lipid nanodisc
Published: 2020-05-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Structure of the human ER membrane protein complex in a lipid nanodisc. Determined by electron microscopy at 3.4 Å resolution. Released 27 May 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 9
Atoms: 16,576
Mol. weight: 283.67 kDa
Ligands: NAG
Released: 27 May 2020

Explore 6WW7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WW7 contains 72 α-helices and 106 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 68 β-strands

Element	Residues	Length	Sheet
β-strand	32-34	3	1
β-strand	40-44	5	2
β-strand	54-58	5	2
β-strand	62-66	5	2
β-strand	73-78	6	2
α-helix	83-85	3
β-strand	87-93	7	3
β-strand	96-101	6	3
β-strand	106-111	6	3
β-strand	117-122	6	3
α-helix	123-124	2
β-strand	128-135	8	4
β-strand	140-147	8	4
β-strand	150-155	6	4
β-strand	161-166	6	4
β-strand	174-180	7	5
β-strand	185-191	7	5
β-strand	197-203	7	5
β-strand	209-215	7	5
β-strand	228-230	3	6
β-strand	234-239	6	6
β-strand	244-249	6	6
β-strand	257-260	4	6
α-helix	268-269	2
β-strand	275-277	3	7
β-strand	290-296	7	7
β-strand	299-306	8	7
β-strand	309-317	9	7
β-strand	319-325	7	8
β-strand	332-338	7	8
β-strand	372-379	8	8
β-strand	385-394	10	8
β-strand	402-411	10	9
β-strand	417-425	9	9
β-strand	429-433	5	9
β-strand	441-446	6	9
α-helix	447-451	5
β-strand	452-459	8	10
α-helix	460-463	4
α-helix	469-472	4
α-helix	480-501	22
β-strand	534-540	7	10
β-strand	544-549	6	10
β-strand	555-560	6	10
β-strand	569-576	8	11
α-helix	584-585	2
β-strand	586-592	7	11
β-strand	599-604	6	11
α-helix	610	1
β-strand	611	1	11
α-helix	612	1
α-helix	615-617	3
β-strand	625-632	8	12
β-strand	638-643	6	12
β-strand	648	1	13
β-strand	649-652	4	12
α-helix	656-663	8
α-helix	666-668	3
β-strand	669-675	7	14
β-strand	680-686	7	14
β-strand	691	1	13
β-strand	692-699	8	14
β-strand	705-712	8	15
α-helix	713-714	2
β-strand	723-725	3	16
β-strand	731-733	3	16
β-strand	734	1	17
β-strand	740-747	8	15
β-strand	756-763	8	15
β-strand	769-776	8	15
β-strand	778-786	9	17
β-strand	790-797	8	17
β-strand	802-811	10	17
β-strand	821-822	2	18
α-helix	830-831	2
β-strand	832-840	9	17
β-strand	846-849	4	19
α-helix	858-859	2
β-strand	860-864	5	19
β-strand	870-874	5	19
α-helix	875-877	3
α-helix	888-892	5
α-helix	896-898	3
β-strand	901	1	17
α-helix	906-908	3
β-strand	921-925	5	1
β-strand	933-938	6	1
β-strand	942-947	6	1
α-helix	962-991	30

Chain B: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	12-24	13
α-helix	30-42	13
α-helix	52-66	15
α-helix	69-82	14
α-helix	87-99	13
α-helix	103-114	12
α-helix	122-134	13
α-helix	137-150	14
α-helix	157-167	11
α-helix	171-184	14
α-helix	189-202	14
α-helix	205-221	17
α-helix	227-240	14
α-helix	247-274	28
α-helix	281-288	8

Chain C: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	13-17	5
α-helix	18-37	20
α-helix	46-64	19
α-helix	70-80	11
α-helix	87-90	4
α-helix	115-131	17
β-strand	138-139	2	20
α-helix	146-148	3
α-helix	149-152	4
β-strand	165-166	2	20
α-helix	168-178	11
α-helix	183-186	4
α-helix	214-225	12
α-helix	237-242	6

Chain D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	172-173	2	18
β-strand	176-181	6	14

Chain E: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-34	29
α-helix	43-63	21
β-strand	71	1	21
α-helix	72-74	3
α-helix	81-83	3
α-helix	97-100	4

Chain F: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	14	1	21
α-helix	16-44	29
α-helix	49-70	22
α-helix	83-86	4
α-helix	89-107	19

Chain G: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	44-50	7	22
β-strand	52	1	23
α-helix	58-60	3
α-helix	62-64	3
β-strand	66-69	4	24
β-strand	74-76	3	24
β-strand	78	1	22
β-strand	79	1	3
β-strand	83-90	8	22
β-strand	92-99	8	24
β-strand	105	1	25
β-strand	108-112	5	24
β-strand	118-121	4	24
β-strand	134	1	24
β-strand	138	1	22
β-strand	141	1	23
β-strand	142	1	25

Chain H: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	26
α-helix	8-20	13
β-strand	26-33	8	27
β-strand	53-54	2	26
β-strand	56-62	7	27
α-helix	68-82	15
β-strand	87-95	9	27
α-helix	106-116	11
β-strand	123-127	5	27
β-strand	141-146	6	27
β-strand	151-153	3	27
α-helix	164-175	12
α-helix	186-191	6
α-helix	200-208	9

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ER membrane protein complex subunit 1	A	protein	993	Homo sapiens	Q8N766 (AlphaFold model)
ER membrane protein complex subunit 2	B	protein	297	Homo sapiens	Q15006 (AlphaFold model)
ER membrane protein complex subunit 3	C	protein	261	Homo sapiens	Q9P0I2 (AlphaFold model)
ER Membrane Protein Complex Subunit 4	D	protein	14	Homo sapiens
Membrane magnesium transporter 1	E	protein	131	Homo sapiens	Q8N4V1 (AlphaFold model)
ER membrane protein complex subunit 6	F	protein	110	Homo sapiens	Q9BV81
ER membrane protein complex subunit 7	G	protein	242	Homo sapiens	Q9NPA0
ER membrane protein complex subunit 8	H	protein	210	Homo sapiens	O43402
ER membrane protein complex subunit 10	I	protein	262	Homo sapiens	Q5UCC4

Sequence of entity 1 (A), FASTA

>6WW7_1 ER membrane protein complex subunit 1 (chains A)
MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEK
NVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWE
ITLDSGSFQALGLVGLQESVRYIAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYS
YGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDP
SSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHY
ALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVQKSSSSEDGSMGSFSEKS
SSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYR
ALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGL
LGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVT
ASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKESGMSS
LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLR
QLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTIPPEVQRIVKVKGKRSSEHVH
SQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHERTFIGIFLIDGVTGRIIHSSVQKKAKG
PVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFSSLDRPQLPQVLQQSYIF
PSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSP
DVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDY
DYVLISSVLFGLVFATMITKRLAQVKLLNRAWR

Sequence of entity 2 (B), FASTA

>6WW7_2 ER membrane protein complex subunit 2 (chains B)
MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVM
IAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTN
TAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEE
LMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIA
SNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS

Sequence of entity 3 (C), FASTA

>6WW7_3 ER membrane protein complex subunit 3 (chains C)
MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRV
LRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLP
MILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLR
SIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEE
LMAKDLHFEGMFKKELQTSIF

Sequence of entity 4 (D), FASTA

>6WW7_4 ER Membrane Protein Complex Subunit 4 (chains D)
XXXXXXXXXXXXXX

Sequence of entity 5 (E), FASTA

>6WW7_5 Membrane magnesium transporter 1 (chains E)
MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGI
VHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTS
LKLRKLESLRR

Sequence of entity 6 (F), FASTA

>6WW7_6 ER membrane protein complex subunit 6 (chains F)
MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV
LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Sequence of entity 7 (G), FASTA

>6WW7_7 ER membrane protein complex subunit 7 (chains G)
MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQD
WISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRA
RYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLP
KVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGK
RR

Sequence of entity 8 (H), FASTA

>6WW7_8 ER membrane protein complex subunit 8 (chains H)
MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPL
FHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFS
DTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSY
ETLVDFDNHLDDIRNDWTNPEINKAVLHLC

Sequence of entity 9 (I), FASTA

>6WW7_9 ER membrane protein complex subunit 10 (chains I)
MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSF
EIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALD
GLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLEL
FNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMS
GAPDTGGQGGGGGGGGGGGSGR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structural basis for membrane insertion by the human ER membrane protein complex. Pleiner, T., Tomaleri, G.P., Januszyk, K. et al. Science (2020) 369:433-436. DOI 10.1126/science.abb5008 · PubMed

Other PDB entries of the same protein (UniProt Q8N766 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8J0O 3.32 Å, cryo-EM structure of human EMC and VDAC
7ADO 3.39 Å, Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs
8EOI 3.4 Å, Structure of a human EMC:human Cav1.2 channel complex in GDN detergent
8J0N 3.47 Å, cryo-EM structure of human EMC
7ADP 3.6 Å, Cryo-EM structure of human ER membrane protein complex in GDN detergent
8S9S 3.6 Å, Structure of the human ER membrane protein complex (EMC) in GDN
9ZZ6 4.16 Å, The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium…
6Z3W 6.4 Å, Human ER membrane protein complex
9C7V 6.6 Å, Structure of the human BOS:human EMC complex in GDN

Browse structure collections

About this viewer

MolViewer shows 6WW7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.