6WXJ: Macrophage colony-stimulating factor 1 receptor

CSF1R signaling is a regulator of pathogenesis in progressive MS. Determined by X-ray diffraction at 2.62 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 2.62 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,289
Mol. weight: 38.18 kDa
Ligands: UF4
Released: 10 Feb 2021

Explore 6WXJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WXJ contains 15 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	566-568	3
α-helix	570-571	2
β-strand	576	1	1
β-strand	582-590	9	1
β-strand	594-604	11	1
β-strand	609-618	10	1
α-helix	626-640	15
β-strand	646	1	2
β-strand	649-653	5	1
β-strand	660-664	5	1
β-strand	670	1	2
α-helix	671-677	7
α-helix	754-771	18
α-helix	781-783	3
β-strand	784-787	4	2
β-strand	791-794	4	2
α-helix	798-800	3
α-helix	819-821	3
α-helix	824-828	5
α-helix	834-846	13
α-helix	853-854	2
α-helix	863-870	8
α-helix	875-878	4
α-helix	883-892	10
α-helix	903-915	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Macrophage colony-stimulating factor 1 receptor	A	protein	332	Homo sapiens	P07333 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6WXJ_1 Macrophage colony-stimulating factor 1 receptor (chains A)
YKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVV
EATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGG
PVLVITEYCCYGDLLNFLRRKSPPGLEYSYNPSHNPEEQLSSRDLLHFSSQVAQGMAFLA
SKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDC
VYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQ
ACWALEPTHRPTFQQICSFLQEQAQEDRRERD

Ligands and cofactors

ID	Name	Formula	Copies
UF4	4-(3-{[(2S)-2-(6-methoxypyridin-3-yl)-2,3-dihydro-1,4-benzodioxin-6-yl]methyl}-…	C26 H25 N5 O3	1

Primary citation

CSF1R signaling is a regulator of pathogenesis in progressive MS. Hagan, N., Kane, J.L., Grover, D. et al. Cell Death Dis (2020) 11:904-904. DOI 10.1038/s41419-020-03084-7 · PubMed

Other PDB entries of the same protein (UniProt P07333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JOT 1.69 Å, Crystal structure of CSF-1R kinase domain with sulfatinib
6T2W 1.7 Å, Crystal structure of the CSF1R kinase domain with a dihydropurinone inhibitor (compound 4)
2I1M 1.8 Å, cFMS tyrosine kinase (tie2 KID) in complex with an arylamide inhibitor
6IG8 1.8 Å, Crystal structure of CSF-1R kinase domain with a small molecular inhibitor, JTE-952
2I0Y 1.9 Å, cFMS tyrosine kinase (FGF KID) in complex with an arylamide inhibitor
8CGC 1.93 Å, Structure of CSF1R in complex with a pyrollopyrimidine (compound 23)
3DPK 1.95 Å, cFMS tyrosine kinase in complex with a pyridopyrimidinone inhibitor
3BEA 2.02 Å, cFMS tyrosine kinase (tie2 KID) in complex with a pyrimidinopyridone inhibitor
3KRJ 2.1 Å, cFMS tyrosine kinase in complex with 4-Cyano-1H-imidazole-2-carboxylic acid…
6N33 2.25 Å, Crystal structure of fms kinase domain with a small molecular inhibitor, PLX5622
8W1L 2.26 Å, Structure of CSF1R kinase domain in complex with Cpd 32
3KRL 2.4 Å, cFMS Tyrosine kinase in complex with 5-Cyano-furan-2-carboxylic acid…

Browse structure collections

About this viewer

MolViewer shows 6WXJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.