Structure of SARS-CoV-2 Nucleocapsid dimerization domain, P1 form. Determined by X-ray diffraction at 1.42 Å resolution. Released 27 May 2020.
Explore 6WZO in 3D Show helices and sheets RCSB PDB PDBe
6WZO contains 36 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 259-261 | 3 | |
| β-strand | 265 | 1 | 1 |
| β-strand | 268 | 1 | 1 |
| α-helix | 270-274 | 5 | |
| β-strand | 286 | 1 | 2 |
| α-helix | 289-294 | 6 | |
| α-helix | 295-297 | 3 | |
| α-helix | 301-305 | 5 | |
| α-helix | 309-310 | 2 | |
| α-helix | 311-317 | 7 | |
| β-strand | 319-325 | 7 | 3 |
| β-strand | 328-338 | 11 | 3 |
| α-helix | 346-356 | 11 | |
| β-strand | 357 | 1 | 2 |
| α-helix | 359-362 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 259-261 | 3 | |
| α-helix | 270-274 | 5 | |
| β-strand | 286 | 1 | 4 |
| α-helix | 289-294 | 6 | |
| α-helix | 295-297 | 3 | |
| α-helix | 301-305 | 5 | |
| α-helix | 309-310 | 2 | |
| α-helix | 311-317 | 7 | |
| β-strand | 319-325 | 7 | 3 |
| β-strand | 328-338 | 11 | 3 |
| α-helix | 346-356 | 11 | |
| β-strand | 357 | 1 | 4 |
| α-helix | 359-362 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nucleoprotein | A, B, C, D | protein | 121 | Severe acute respiratory syndrome coronavirus 2 | P0DTC9 (AlphaFold model) |
>6WZO_1 Nucleoprotein (chains A, B, C, D) SNATKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQ IAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTF P
Architecture and self-assembly of the SARS-CoV-2 nucleocapsid protein. Ye, Q., West, A.M.V., Silletti, S. et al. Protein Sci (2020) 29:1890-1901. DOI 10.1002/pro.3909 · PubMed
Other PDB entries of the same protein (UniProt P0DTC9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6WZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.