6X0R: Capsid protein Circular Permutant

A Circular Permutant of the Tobacco Mosaic Virus (TMV) mutant Q101H. Determined by X-ray diffraction at 3.0 Å resolution. Released 9 Dec 2020.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Tobacco mosaic virus (strain vulgare)
Chains: 17
Atoms: 18,581
Mol. weight: 301.15 kDa
Released: 9 Dec 2020

Explore 6X0R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6X0R contains 119 α-helices and 102 β-strands across 17 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, D, F, G, H, O, P and Q: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	16-36	21
β-strand	40-41	2	1
α-helix	43-49	7
β-strand	53-55	3	2
β-strand	63-65	3	2
α-helix	69-73	5
β-strand	79-80	2	1
α-helix	82-92	11
α-helix	100-112	13
β-strand	115	1	1
α-helix	123-125	3
β-strand	130-132	3	1
α-helix	138-148	11

Chains B, C, E, I, J, K, L, M and N: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	16-36	21
β-strand	40-41	2	3
α-helix	43-50	8
β-strand	53-55	3	4
β-strand	63-65	3	4
α-helix	69-73	5
β-strand	79-80	2	3
α-helix	82-92	11
α-helix	100-112	13
β-strand	115	1	3
α-helix	123-125	3
β-strand	130-132	3	3
α-helix	138-148	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein Circular Permutant	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q	protein	161	Tobacco mosaic virus (strain vulgare)	P69687

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q), FASTA

>6X0R_1 Capsid protein Circular Permutant (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q)
GANPTTAETLDATRRVDDATVAIRSAINNLIVELIRGTGSYNRSSFESSSGLVWTSGPAG
EGSYSITTPSQFVFLSSAWADPIELINLCTNALGNQFQTQHARTVVQRQFSEVWKPSPQV
TVRFPDSDFKVYRYNAVLDPLVTALLGAFDTRNRIIEVENQ

Primary citation

Protein-Embedded Metalloporphyrin Arrays Templated by Circularly Permuted Tobacco Mosaic Virus Coat Proteins. Dai, J., Knott, G.J., Fu, W. et al. ACS Nano (2021) 15:8110-8119. DOI 10.1021/acsnano.0c07165 · PubMed

Other PDB entries of the same protein (UniProt P69687), best resolution first:

6SAE 1.9 Å, Cryo-EM structure of TMV in water
6R7M 1.92 Å, Tobacco Mosaic Virus (TMV)
6SAG 2.0 Å, Cryo-EM structure of TMV with Ca2+ at low pH
6I5A 2.3 Å, Tobacco Mosaic Virus
6RLP 2.3 Å, Cryo-EM reconstruction of TMV coat protein
1EI7 2.45 Å, Tmv coat protein refined from the 4-layer aggregate
8EAW 2.8 Å, An asymmetric disk assembly formed by tandem dimers of the tobacco mosaic viral capsid…
2TMV 2.9 Å, Visualization of protein-nucleic acid interactions in a virus. Refined structure of…
6X0Q 3.0 Å, A Circular Permutant of the Tobacco Mosaic Virus (TMV) mutant Q101H coordinated with heme
3KML 3.01 Å, Circular Permutant of the Tobacco Mosaic Virus
4GQH 3.06 Å, The Conformations and Interactions of the Four-Layer Aggregate Revealed by X-ray…
3J06 3.3 Å, CryoEM Helical Reconstruction of TMV

Browse structure collections

About this viewer

MolViewer shows 6X0R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.