6X3W: Human GABAA receptor alpha1-beta2-gamma2 subtype
Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus phenobarbital. Determined by electron microscopy at 3.3 Å resolution. Released 9 Sept 2020.
- Method
- Electron microscopy
- Resolution
- 3.3 Å
- Organisms
- Homo sapiens, Mus musculus
- Chains
- 9
- Atoms
- 17,399
- Mol. weight
- 364.7 kDa
- Ligands
- NAG, UQA, ABU
- Released
- 9 Sept 2020
Explore 6X3W in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6X3W contains 54 α-helices and 114 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 10 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-19 | 11 | |
| α-helix | 35 | 1 | |
| β-strand | 36-47 | 12 | 1 |
| β-strand | 51 | 1 | 1 |
| β-strand | 56-68 | 13 | 1 |
| β-strand | 81-83 | 3 | 1 |
| α-helix | 85-89 | 5 | |
| β-strand | 96-98 | 3 | 2 |
| β-strand | 101-106 | 6 | 1 |
| β-strand | 110 | 1 | 3 |
| β-strand | 114-118 | 5 | 1 |
| β-strand | 123-135 | 13 | 1 |
| β-strand | 147-156 | 10 | 2 |
| β-strand | 164-168 | 5 | 1 |
| β-strand | 175-176 | 2 | 1 |
| β-strand | 186-200 | 15 | 2 |
| β-strand | 203-216 | 14 | 2 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-237 | 11 | |
| α-helix | 238-241 | 4 | |
| α-helix | 247-271 | 25 | |
| α-helix | 280-304 | 25 | |
| α-helix | 310-338 | 29 | |
Chain B: 11 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-22 | 10 | |
| β-strand | 39-54 | 16 | 4 |
| β-strand | 59-71 | 13 | 4 |
| α-helix | 73-75 | 3 | |
| β-strand | 83-86 | 4 | 4 |
| α-helix | 91-93 | 3 | |
| β-strand | 99-101 | 3 | 5 |
| β-strand | 104 | 1 | 4 |
| β-strand | 108-109 | 2 | 4 |
| β-strand | 113 | 1 | 2 |
| β-strand | 117-122 | 6 | 4 |
| β-strand | 126-138 | 13 | 4 |
| β-strand | 150-159 | 10 | 5 |
| β-strand | 167-171 | 5 | 4 |
| α-helix | 175-177 | 3 | |
| β-strand | 179-181 | 3 | 4 |
| β-strand | 186 | 1 | 4 |
| β-strand | 193-205 | 13 | 5 |
| β-strand | 208-220 | 13 | 5 |
| α-helix | 224-226 | 3 | |
| α-helix | 227-231 | 5 | |
| α-helix | 232-243 | 12 | |
| α-helix | 244-246 | 3 | |
| α-helix | 252-276 | 25 | |
| α-helix | 285-310 | 26 | |
| α-helix | 315-344 | 30 | |
Chain C: 11 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-20 | 12 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 6 |
| β-strand | 56-68 | 13 | 6 |
| β-strand | 81-83 | 3 | 6 |
| α-helix | 87-89 | 3 | |
| β-strand | 96-98 | 3 | 7 |
| β-strand | 101-106 | 6 | 6 |
| β-strand | 110 | 1 | 5 |
| β-strand | 114-118 | 5 | 6 |
| β-strand | 123-135 | 13 | 6 |
| β-strand | 147-156 | 10 | 7 |
| β-strand | 164-168 | 5 | 6 |
| β-strand | 175-176 | 2 | 6 |
| β-strand | 186-199 | 14 | 7 |
| β-strand | 204-216 | 13 | 7 |
| α-helix | 217 | 1 | |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-235 | 9 | |
| α-helix | 238-241 | 4 | |
| α-helix | 247-267 | 21 | |
| α-helix | 280-304 | 25 | |
| α-helix | 310-338 | 29 | |
Chain D: 9 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-22 | 12 | |
| β-strand | 39-54 | 16 | 8 |
| β-strand | 59-71 | 13 | 8 |
| β-strand | 83-86 | 4 | 8 |
| β-strand | 99-101 | 3 | 9 |
| β-strand | 104 | 1 | 8 |
| β-strand | 108-109 | 2 | 8 |
| β-strand | 117-122 | 6 | 8 |
| β-strand | 126-138 | 13 | 8 |
| β-strand | 150-154 | 5 | 9 |
| β-strand | 157-159 | 3 | 9 |
| β-strand | 167-171 | 5 | 8 |
| α-helix | 175-177 | 3 | |
| β-strand | 179-181 | 3 | 8 |
| β-strand | 186 | 1 | 8 |
| β-strand | 191-204 | 14 | 9 |
| β-strand | 209-221 | 13 | 9 |
| α-helix | 224-226 | 3 | |
| α-helix | 227-231 | 5 | |
| α-helix | 232-242 | 11 | |
| α-helix | 243-246 | 4 | |
| α-helix | 252-274 | 23 | |
| α-helix | 285-309 | 25 | |
| α-helix | 315-345 | 31 | |
Chain E: 10 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-34 | 8 | |
| α-helix | 50 | 1 | |
| β-strand | 51-62 | 12 | 10 |
| β-strand | 71-83 | 13 | 10 |
| β-strand | 95-98 | 4 | 10 |
| α-helix | 100-105 | 6 | |
| β-strand | 111-113 | 3 | 3 |
| β-strand | 116-121 | 6 | 10 |
| β-strand | 125 | 1 | 9 |
| β-strand | 129-134 | 6 | 10 |
| β-strand | 138-150 | 13 | 10 |
| β-strand | 162-171 | 10 | 3 |
| β-strand | 179-190 | 12 | 10 |
| β-strand | 201-214 | 14 | 3 |
| β-strand | 219-231 | 13 | 3 |
| α-helix | 235-236 | 2 | |
| α-helix | 237-241 | 5 | |
| α-helix | 242-252 | 11 | |
| α-helix | 253-255 | 3 | |
| α-helix | 262-284 | 23 | |
| α-helix | 297-323 | 27 | |
| α-helix | 325-356 | 32 | |
Chain I: 0 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 11 |
| β-strand | 10-12 | 3 | 12 |
| β-strand | 19-25 | 7 | 11 |
| β-strand | 33-38 | 6 | 13 |
| β-strand | 45-49 | 5 | 13 |
| β-strand | 53-54 | 2 | 13 |
| β-strand | 62-65 | 4 | 11 |
| β-strand | 70-75 | 6 | 11 |
| β-strand | 85-90 | 6 | 13 |
| β-strand | 96-97 | 2 | 13 |
| β-strand | 102-104 | 3 | 12 |
Chain J: 1 helix, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 14 |
| β-strand | 10-12 | 3 | 15 |
| β-strand | 17-25 | 9 | 14 |
| β-strand | 34-39 | 6 | 15 |
| β-strand | 45-51 | 7 | 15 |
| β-strand | 58-60 | 3 | 15 |
| β-strand | 68-73 | 6 | 14 |
| β-strand | 78-84 | 7 | 14 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-98 | 7 | 15 |
| β-strand | 107-108 | 2 | 15 |
| β-strand | 112-116 | 5 | 15 |
Chain K: 1 helix, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 18 |
| β-strand | 10-12 | 3 | 19 |
| β-strand | 18-25 | 8 | 18 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 20 |
| β-strand | 45-52 | 8 | 20 |
| β-strand | 57-60 | 4 | 20 |
| β-strand | 68-73 | 6 | 18 |
| β-strand | 78-83 | 6 | 18 |
| β-strand | 93-99 | 7 | 20 |
| β-strand | 105-108 | 4 | 20 |
| β-strand | 112-113 | 2 | 20 |
| β-strand | 114-116 | 3 | 19 |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gamma-aminobutyric acid receptor subunit beta-2 | A, C | protein | 364 | Homo sapiens | P47870 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit alpha-1 | B, D | protein | 358 | Homo sapiens | P14867 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit gamma-2 | E | protein | 417 | Homo sapiens | P18507 (AlphaFold model) |
| Kappa Fab Light Chain | I, L | protein | 213 | Mus musculus | |
| IgG2b Fab Heavy Chain | J, K | protein | 454 | Mus musculus | |
Sequence of entity 1 (A, C), FASTA
>6X3W_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A, C)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFSQPARAAAIDRWSRIFFPVVFSFFNIVYWLYYVNVDGSGATNFSLLKQAGDVE
ENPG
Sequence of entity 2 (B, D), FASTA
>6X3W_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B, D)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKSQPARAAKIDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Sequence of entity 3 (E), FASTA
>6X3W_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
WSHPQFEKGGGSGGGSGGSSAWSHPQFEKLEVLFQGPQKSDDDYEDYASNKTWVLTPKVP
EGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWY
DRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTL
RLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSF
VGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSS
QPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYLSRGSGATNFSLLKQAGDVEENPG
Sequence of entity 4 (I, L), FASTA
>6X3W_4 Kappa Fab Light Chain (chains I, L)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Sequence of entity 5 (J, K), FASTA
>6X3W_5 IgG2b Fab Heavy Chain (chains J, K)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
| UQA | 5-ethyl-5-phenylpyrimidine-2,4,6(1H,3H,5H)-trione | C12 H12 N2 O3 | 2 |
| ABU | Gamma-amino-butanoic acid | C4 H9 N O2 | 2 |
Primary citation
Shared structural mechanisms of general anaesthetics and benzodiazepines. Kim, J.J., Gharpure, A., Teng, J. et al. Nature (2020) 585:303-308. DOI 10.1038/s41586-020-2654-5 · PubMed
Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
- 8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
- 8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
- 8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
- 8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
- 6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
- 8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
- 8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
- 9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
- 6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
- 9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
- 8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
Browse structure collections
About this viewer
MolViewer shows 6X3W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.