6XAW: Crystal Structure Analysis of SIN3-UME6

Crystal Structure Analysis of SIN3-UME6. Determined by X-ray diffraction at 1.84 Å resolution. Released 9 Jun 2021.

Method: X-ray diffraction
Resolution: 1.84 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 798
Mol. weight: 14.22 kDa
Released: 9 Jun 2021

Explore 6XAW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XAW contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	406-421	16
α-helix	426-441	16
α-helix	446-456	11
α-helix	461-468	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	517-528	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional regulatory protein SIN3	A	protein	76	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P22579 (AlphaFold model)
Transcriptional regulatory protein UME6	B	protein	46	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P39001 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6XAW_1 Transcriptional regulatory protein SIN3 (chains A)
GPHMKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLF
QNAPDLLEDFKKFLPD

Sequence of entity 2 (B), FASTA

>6XAW_2 Transcriptional regulatory protein UME6 (chains B)
GPRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDKPIS

Primary citation

Crystal Structure Analysis of SIN3-UME6. Seo, H.-S. To be published.

Other PDB entries of the same protein (UniProt P22579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XDJ 2.2 Å, Crystal Structure Analysis of MBP-SIN3
8HPO 2.6 Å, Cryo-EM structure of a SIN3/HDAC complex from budding yeast
8TOF 2.8 Å, Rpd3S bound to an H3K36Cme3 modified nucleosome
8KD3 2.9 Å, Rpd3S in complex with nucleosome with H3K36MLA modification, H3K9Q mutation and 187bp DNA
8KD5 2.9 Å, Rpd3S in complex with nucleosome with H3K36MLA modification and 187bp DNA, class2
8KD4 2.93 Å, Rpd3S in complex with nucleosome with H3K36MLA modification and 187bp DNA, class1
8HXX 3.0 Å, Cryo-EM structure of the histone deacetylase complex Rpd3S
9V2V 3.0 Å, Cryo-EM structure of the histone deacetylase complex Rpd3L in complex with mono-nucleosome
8KD2 3.02 Å, Rpd3S in complex with 187bp nucleosome
8KD6 3.07 Å, Rpd3S in complex with nucleosome with H3K36MLA modification and 187bp DNA, class3
8KD7 3.09 Å, Rpd3S in complex with nucleosome with H3K36MLA modification and 167bp DNA
8HXY 3.1 Å, Cryo-EM structure of the histone deacetylase complex Rpd3S in complex with nucleosome

Browse structure collections

About this viewer

MolViewer shows 6XAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.