Human SUN2-KASH1 complex. Determined by X-ray diffraction at 2.32 Å resolution. Released 6 Jun 2012.
Explore 4DXR in 3D Show helices and sheets RCSB PDB PDBe
4DXR contains 9 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 525-540 | 16 | |
| α-helix | 552-554 | 3 | |
| β-strand | 557-560 | 4 | 1 |
| β-strand | 566 | 1 | 2 |
| β-strand | 572-576 | 5 | 3 |
| β-strand | 579-584 | 6 | 3 |
| α-helix | 588-592 | 5 | |
| β-strand | 602-605 | 4 | 2 |
| β-strand | 609-627 | 19 | 1 |
| α-helix | 631-633 | 3 | |
| α-helix | 635-637 | 3 | |
| β-strand | 643 | 1 | 4 |
| β-strand | 645-651 | 7 | 1 |
| α-helix | 658-659 | 2 | |
| β-strand | 660-666 | 7 | 1 |
| β-strand | 674-678 | 5 | 1 |
| α-helix | 679 | 1 | |
| β-strand | 687-694 | 8 | 1 |
| β-strand | 697 | 1 | 4 |
| β-strand | 703-706 | 4 | 2 |
| β-strand | 708-715 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8780-8782 | 3 | |
| β-strand | 8787-8790 | 4 | 3 |
| α-helix | 8794-8796 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SUN domain-containing protein 2 | A | protein | 202 | Homo sapiens | Q9UH99 (AlphaFold model) |
| Nesprin-1 | B | protein | 35 | Homo sapiens | Q8NF91 (AlphaFold model) |
>4DXR_1 SUN domain-containing protein 2 (chains A) GPGGSGGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLS LFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSP NSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRIL TNWGHPEYTCIYRFRVHGEPAH
>4DXR_2 Nesprin-1 (chains B) GPGGSGEEDYSCALSNNFARSFHPMLRYTNGPPPL
| ID | Name | Formula | Copies |
|---|---|---|---|
| DMU | Decyl-beta-D-maltopyranoside | C22 H42 O11 | 1 |
Water and common crystallization additives (K) are not listed.
LINC Complexes Form by Binding of Three KASH Peptides to Domain Interfaces of Trimeric SUN Proteins. Sosa, B.A., Rothballer, A., Kutay, U. et al. Cell (2012) 149:1035-1047. DOI 10.1016/j.cell.2012.03.046 · PubMed
Other PDB entries of the same protein (UniProt Q9UH99 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4DXR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.