6XL9: DNA-directed RNA polymerase subunit alpha

Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA transcript (EcmrR-RPitc-3nt). Determined by electron microscopy at 2.5 Å resolution. Released 7 Apr 2021.

Method: Electron microscopy
Resolution: 2.5 Å
Organism: Escherichia coli O157:H7
Chains: 10
Atoms: 35,113
Mol. weight: 548.4 kDa
Ligands: ZN, 118, MG
Released: 7 Apr 2021

Explore 6XL9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XL9 contains 180 α-helices and 239 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-31	9	1
α-helix	36-47	12
β-strand	53-61	9	2
β-strand	74	1	3
α-helix	78-85	8
β-strand	90-92	3	4
β-strand	97-105	9	2
β-strand	108-111	4	3
α-helix	112-114	3
β-strand	115	1	2
α-helix	116-117	2
β-strand	121-123	3	4
β-strand	129-133	5	3
β-strand	139-149	11	2
β-strand	152-153	2	5
α-helix	155-158	4
β-strand	170-172	3	2
β-strand	175-176	2	5
β-strand	180-189	10	1
β-strand	199-207	9	1
α-helix	213-227	15
α-helix	229-232	4

Chain B: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	6
β-strand	17-20	4	7
β-strand	23-31	9	7
α-helix	36-49	14
β-strand	52-61	10	8
β-strand	74	1	8
α-helix	78-84	7
β-strand	90-92	3	9
β-strand	97-111	15	8
α-helix	112-114	3
β-strand	121-123	3	9
β-strand	129-150	22	8
β-strand	152-153	2	10
α-helix	155-160	6
α-helix	166-167	2
β-strand	170-172	3	8
β-strand	175-176	2	10
β-strand	180-192	13	7
β-strand	195-207	13	7
α-helix	213-225	13

Chain C: 53 helices, 95 β-strands

Element	Residues	Length	Sheet
α-helix	11-12	2
β-strand	13-14	2	11
α-helix	29-35	7
α-helix	50-53	4
α-helix	57-58	2
β-strand	59-60	2	12
β-strand	66-75	10	12
α-helix	82-88	7
β-strand	93-104	12	12
β-strand	116-128	13	12
β-strand	136-138	3	13
β-strand	141-145	5	13
α-helix	146	1
β-strand	147-151	5	14
α-helix	152	1
β-strand	154-160	7	15
β-strand	171-177	7	15
β-strand	180	1	16
β-strand	184-187	4	15
β-strand	195-198	4	15
β-strand	204-205	2	15
α-helix	208-211	4
α-helix	217-224	8
β-strand	227-231	5	17
β-strand	238-239	2	17
α-helix	243-246	4
β-strand	250	1	18
β-strand	268	1	18
α-helix	271-279	9
β-strand	285-286	2	17
α-helix	295	1
β-strand	296	1	19
β-strand	297	1	17
β-strand	301-302	2	20
β-strand	309-311	3	20
β-strand	316	1	19
α-helix	319-326	8
β-strand	332-336	5	17
α-helix	346-350	5
α-helix	359-370	12
α-helix	380-388	9
β-strand	396	1	16
α-helix	399-408	10
α-helix	422-436	15
β-strand	451-454	4	14
α-helix	456-459	4
α-helix	461-478	18
α-helix	489-491	3
α-helix	496-508	13
β-strand	512-514	3	13
α-helix	515-516	2
α-helix	520-526	7
β-strand	529-531	3	14
α-helix	552-554	3
β-strand	558	1	21
β-strand	572-574	3	14
β-strand	575	1	21
β-strand	580-581	2	22
β-strand	587-595	9	22
β-strand	598-607	10	22
α-helix	610-613	4
β-strand	616-617	2	22
β-strand	623	1	23
β-strand	629	1	23
β-strand	634-638	5	22
β-strand	641-645	5	22
β-strand	652-654	3	22
α-helix	671-673	3
β-strand	674	1	24
α-helix	676-685	10
α-helix	686-688	3
β-strand	689	1	25
α-helix	690-692	3
β-strand	700-701	2	11
α-helix	705-710	6
β-strand	716-717	2	26
β-strand	722-727	6	27
β-strand	731-736	6	27
β-strand	748-752	5	27
β-strand	757-758	2	28
β-strand	763	1	29
β-strand	764-765	2	28
β-strand	768-769	2	26
β-strand	776-777	2	27
β-strand	782-785	4	26
β-strand	789	1	30
β-strand	794	1	30
β-strand	798-804	7	31
β-strand	816-819	4	31
α-helix	820-823	4
β-strand	830-841	12	29
β-strand	849-850	2	32
β-strand	865	1	33
β-strand	870	1	34
β-strand	871	1	33
α-helix	872	1
β-strand	876-878	3	29
β-strand	882-884	3	34
β-strand	886-889	4	32
α-helix	897-906	10
β-strand	913-915	3	32
β-strand	918-919	2	34
α-helix	920-921	2
β-strand	925-935	11	29
β-strand	936	1	35
α-helix	943-957	15
α-helix	961-979	19
α-helix	986-989	4
α-helix	1005-1036	32
β-strand	1040	1	35
α-helix	1042-1043	2
β-strand	1046-1058	13	29
β-strand	1065-1067	3	36
β-strand	1073-1075	3	36
β-strand	1076-1080	5	31
α-helix	1082-1084	3
β-strand	1087-1088	2	37
β-strand	1093	1	37
β-strand	1096-1098	3	31
α-helix	1100-1102	3
β-strand	1108	1	24
α-helix	1110-1133	24
α-helix	1138-1149	12
α-helix	1161-1163	3
α-helix	1166-1176	11
β-strand	1182-1183	2	11
α-helix	1192-1201	10
β-strand	1209-1210	2	38
β-strand	1212-1213	2	37
β-strand	1220	1	37
β-strand	1225-1226	2	38
β-strand	1227-1232	6	31
β-strand	1233-1234	2	36
β-strand	1235	1	25
α-helix	1239-1242	4
β-strand	1244-1246	3	39
β-strand	1251	1	40
β-strand	1252	1	41
β-strand	1258	1	40
β-strand	1260	1	42
β-strand	1267	1	42
β-strand	1268-1270	3	43
α-helix	1272-1281	10
α-helix	1284-1291	8
α-helix	1292-1296	5
α-helix	1300-1309	10
α-helix	1321-1331	11
β-strand	1335-1340	6	44

Chain D: 64 helices, 77 β-strands

Element	Residues	Length	Sheet
β-strand	19-24	6	44
α-helix	27-32	6
β-strand	34-37	4	45
β-strand	44	1	46
β-strand	51	1	46
α-helix	52	1
α-helix	59-62	4
β-strand	84	1	47
β-strand	91	1	47
α-helix	95-99	5
β-strand	102-112	11	45
α-helix	115-118	4
α-helix	122	1
α-helix	123-128	6
α-helix	132-138	7
β-strand	145-148	4	48
β-strand	159	1	48
α-helix	162-171	10
β-strand	177-179	3	48
α-helix	182-191	10
α-helix	194-202	9
α-helix	211-230	20
α-helix	234-237	4
β-strand	238-244	7	45
α-helix	247-249	3
β-strand	252-254	3	49
β-strand	260-262	3	49
α-helix	264-285	22
α-helix	289-307	19
α-helix	315-316	2
β-strand	317	1	50
β-strand	323	1	50
α-helix	324-325	2
α-helix	337	1
α-helix	338-342	5
β-strand	345-347	3	43
β-strand	350-354	5	39
β-strand	355-357	3	51
β-strand	365-369	5	51
α-helix	370-376	7
α-helix	378-387	10
α-helix	394-403	10
α-helix	408-415	8
β-strand	421-424	4	39
α-helix	431-433	3
β-strand	434-437	4	39
β-strand	438-442	5	51
β-strand	447-449	3	51
β-strand	465-469	5	39
α-helix	474-482	9
β-strand	485	1	39
α-helix	486-488	3
β-strand	491	1	52
β-strand	498	1	52
α-helix	506-513	8
β-strand	526-527	2	53
α-helix	530-539	10
β-strand	547-556	10	53
β-strand	564-573	10	53
α-helix	574-579	6
α-helix	584	1
α-helix	589-591	3
α-helix	598-611	14
α-helix	615-635	21
α-helix	645-647	3
α-helix	650-665	16
α-helix	675-702	28
β-strand	708	1	54
β-strand	713	1	54
α-helix	721-727	7
α-helix	734-741	8
β-strand	745	1	55
β-strand	748	1	56
α-helix	753	1
β-strand	754	1	56
α-helix	755	1
β-strand	759	1	55
α-helix	769-804	36
β-strand	809-811	3	57
β-strand	820-822	3	58
β-strand	825	1	59
β-strand	833	1	59
α-helix	836-839	4
β-strand	843	1	60
β-strand	844	1	58
β-strand	849	1	61
β-strand	856	1	61
β-strand	863	1	60
α-helix	866-874	9
β-strand	880-882	3	58
β-strand	894-895	2	57
α-helix	896-899	4
β-strand	901	1	62
β-strand	908	1	62
α-helix	909-910	2
α-helix	915-924	10
α-helix	925-928	4
β-strand	949-950	2	63
β-strand	956-961	6	64
β-strand	965-967	3	63
β-strand	973-975	3	63
β-strand	981-985	5	64
β-strand	991-995	5	64
α-helix	997-998	2
α-helix	1001	1
β-strand	1002-1003	2	63
β-strand	1010-1011	2	64
β-strand	1018-1019	2	63
β-strand	1024-1028	5	65
β-strand	1034-1036	3	66
β-strand	1046-1047	2	67
β-strand	1060-1061	2	67
α-helix	1071-1073	3
β-strand	1079-1081	3	66
β-strand	1087	1	66
α-helix	1088-1089	2
β-strand	1090	1	68
β-strand	1093	1	68
α-helix	1109-1110	2
β-strand	1120-1125	6	65
α-helix	1138-1146	9
β-strand	1156	1	69
β-strand	1161-1165	5	70
β-strand	1174-1178	5	70
β-strand	1187-1189	3	70
β-strand	1203-1204	2	70
β-strand	1209	1	69
α-helix	1217-1223	7
α-helix	1226-1242	17
α-helix	1251-1259	9
β-strand	1263-1268	6	71
β-strand	1279-1281	3	71
α-helix	1282-1292	11
β-strand	1301-1304	4	71
α-helix	1309-1313	5
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	44
α-helix	1348-1352	5
α-helix	1360-1362	3
α-helix	1363-1375	13

Chain F: 33 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	97-104	8
α-helix	110-112	3
α-helix	113-133	21
α-helix	144-146	3
α-helix	147-150	4
α-helix	214-219	6
α-helix	221-231	11
α-helix	232-235	4
α-helix	243-256	14
α-helix	265-288	24
α-helix	299-308	10
α-helix	313-316	4
α-helix	317-320	4
α-helix	334-351	18
α-helix	355-380	26
α-helix	384-390	7
α-helix	391-393	3
α-helix	401-418	18
α-helix	421-423	3
α-helix	427-445	19
α-helix	454-474	21
α-helix	477-479	3
α-helix	480-487	8
α-helix	491-497	7
α-helix	503-504	2
β-strand	505-506	2	49
β-strand	510	1	72
β-strand	518	1	72
α-helix	519-521	3
β-strand	524	1	41
α-helix	528-530	3
α-helix	531-547	17
α-helix	553-563	11
α-helix	573-580	8
α-helix	584-597	14
α-helix	604-606	3
α-helix	608-610	3

Chain G: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	73
α-helix	4-10	7
α-helix	15-24	10
β-strand	31-32	2	73
β-strand	39-40	2	73
α-helix	43-56	14
α-helix	62-70	9
α-helix	76-109	34
β-strand	117-121	5	74
β-strand	124-133	10	74
α-helix	136-152	17
β-strand	159	1	74
β-strand	165-169	5	74
β-strand	179-187	9	74
β-strand	194	1	75
β-strand	197	1	75
β-strand	198-202	5	74
β-strand	205-213	9	74
α-helix	216-218	3
α-helix	220-232	13
β-strand	235-237	3	76
β-strand	242-247	6	74
α-helix	255-257	3
β-strand	259-265	7	74
β-strand	266-268	3	76

Chain H: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	77
α-helix	4-11	8
α-helix	15-24	10
β-strand	31-32	2	77
β-strand	39-40	2	77
α-helix	46-56	11
α-helix	62-68	7
α-helix	77-108	32
β-strand	117-121	5	78
β-strand	124-133	10	78
α-helix	137-153	17
β-strand	159	1	79
β-strand	165-169	5	78
β-strand	179-186	8	78
β-strand	187	1	79
β-strand	194	1	80
β-strand	197	1	80
β-strand	198-202	5	78
β-strand	205-213	9	78
α-helix	219-232	14
β-strand	236-237	2	81
β-strand	242-247	6	78
α-helix	255-257	3
β-strand	259-265	7	78
β-strand	266-267	2	81

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	A, B	protein	329	Escherichia coli O157:H7	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	C	protein	1342	Escherichia coli O157:H7	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	D	protein	1407	Escherichia coli O157:H7	P0A8T7 (AlphaFold model)
RNA polymerase sigma factor RpoD	F	protein	613	Escherichia coli O157:H7	P00579 (AlphaFold model)
synthetic non-template strand DNA (54-MER)	N	DNA	54	Escherichia coli O157:H7
RNA (5'-d((gtp))-r(pap*g)-3')	R	RNA	3	Escherichia coli O157:H7
synthetic template strand DNA (54-MER)	T	DNA	54	Escherichia coli O157:H7
MerR family transcriptional regulator EcmrR	G, H	protein	268	Escherichia coli O157:H7	A0A8I3B050

Sequence of entity 1 (A, B), FASTA

>6XL9_1 DNA-directed RNA polymerase subunit alpha (chains A, B)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (C), FASTA

>6XL9_2 DNA-directed RNA polymerase subunit beta (chains C)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (D), FASTA

>6XL9_3 DNA-directed RNA polymerase subunit beta' (chains D)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 4 (F), FASTA

>6XL9_4 RNA polymerase sigma factor RpoD (chains F)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD

Sequence of entity 5 (N), FASTA

>6XL9_5 synthetic non-template strand DNA (54-MER) (chains N)
GCCTTGACCCTCCCCTAAGGGGAGGGTTTAGATTGTGTGCAGTCTGACGCGGCG

Sequence of entity 6 (R), FASTA

>6XL9_6 RNA (5'-D(*(GTP))-R(P*AP*G)-3') (chains R)
GAG

Sequence of entity 7 (T), FASTA

>6XL9_7 synthetic template strand DNA (54-MER) (chains T)
CGCCGCGTCAGACTCGTAGGAATCTAAACCCTCCCCTTAGGGGAGGGTCAAGGC

Sequence of entity 8 (G, H), FASTA

>6XL9_8 MerR family transcriptional regulator EcmrR (chains G, H)
SQIGLFSKICRVTIKTLHYYNKIGLLVPAYINPDNGYRFYTSDQLMKFHQIASLRQLGFT
ITEIVTLTQDENSCHIIERRRLEIQKQIRDMADMLSRINHYLQHKKKERIMLYQAALKEI
PECIVYSKRFIVPDFSSYIKLIPPIGQEVMKANPGLTLTTPAYCFTLYHDKEYKEKNMDV
EFCEAVNDFGKNEGNIIFQVIPAITAVTVIHKGPYDSLRNAYIYLMQWVEDNGYLLTNSP
RESYIDGIWNKQDSAEWMTEIQFPVEKV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
118	Tetraphenylantimonium ion	C24 H20 Sb	3
MG	Magnesium ion	Mg	2

Primary citation

Structural visualization of transcription activated by a multidrug-sensing MerR family regulator. Yang, Y., Liu, C., Zhou, W. et al. Nat Commun (2021) 12:2702-2702. DOI 10.1038/s41467-021-22990-8 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…
9YMV 2.6 Å, De novo initial transcribing RNA polymerase with pretranslocated 3-mer RNA / product…

Browse structure collections

About this viewer

MolViewer shows 6XL9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.